[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : hslV
DDBJ      :hslV         ATP-dependent protease HslV, peptidase subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  589/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
d.153.1
:183 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   7->181 1nedB PDBj 8e-50 56.3 %
:RPS:PDB   7->176 1dooA PDBj 1e-34 62.7 %
:RPS:SCOP  7->181 1e94A  d.153.1.4 * 3e-33 62.1 %
:HMM:SCOP  7->181 1e94A_ d.153.1.4 * 1.9e-50 39.7 %
:RPS:PFM   6->175 PF00227 * Proteasome 4e-10 34.8 %
:HMM:PFM   5->176 PF00227 * Proteasome 2.6e-29 27.2 169/190  
:BLT:SWISS 1->178 HSLV_LEPBP 8e-56 58.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31052.1 GT:GENE hslV GT:PRODUCT ATP-dependent protease HslV, peptidase subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1255383..1255934 GB:FROM 1255383 GB:TO 1255934 GB:DIRECTION + GB:GENE hslV GB:PRODUCT ATP-dependent protease HslV, peptidase subunit GB:PROTEIN_ID ACD31052.1 GB:DB_XREF GI:187712755 GB:GENE:GENE hslV LENGTH 183 SQ:AASEQ MEAIKGTTILCVRKGDKVVIGGDGQATLGHTIAKENIIKVRKLNGGKVLTGFAGSTADAFTLFEKFEQKLEFYQGNLERAAVEMVREWRLDRMLSKLEAMIIVADEKLSLLISGAGDVMAADKNDIISIGSGSTYARSAATALVENTDLSAEEIVRKSLTIAADTCIYTNHNFTIESLENKKG GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 1->178|HSLV_LEPBP|8e-56|58.8|177/177| BL:PDB:NREP 1 BL:PDB:REP 7->181|1nedB|8e-50|56.3|174/181| RP:PDB:NREP 1 RP:PDB:REP 7->176|1dooA|1e-34|62.7|169/173| RP:PFM:NREP 1 RP:PFM:REP 6->175|PF00227|4e-10|34.8|161/189|Proteasome| HM:PFM:NREP 1 HM:PFM:REP 5->176|PF00227|2.6e-29|27.2|169/190|Proteasome| GO:PFM:NREP 3 GO:PFM GO:0004298|"GO:threonine-type endopeptidase activity"|PF00227|IPR001353| GO:PFM GO:0005839|"GO:proteasome core complex"|PF00227|IPR001353| GO:PFM GO:0051603|"GO:proteolysis involved in cellular protein catabolic process"|PF00227|IPR001353| RP:SCP:NREP 1 RP:SCP:REP 7->181|1e94A|3e-33|62.1|174/174|d.153.1.4| HM:SCP:REP 7->181|1e94A_|1.9e-50|39.7|174/174|d.153.1.4|1/1|N-terminal nucleophile aminohydrolases (Ntn hydrolases)| OP:NHOMO 632 OP:NHOMOORG 616 OP:PATTERN -------------------------------------------------------------------- 111--------------------------------------------------------------------------------11111--------1---------111----------------11111111111---------1----------------------------------------11---111111111111111111111111111111111111111111111111111111111111111111111-11111--11111--------------------------------------------------1------------------------------1111111111111111---11-111111111111111111111111111111111-11111111111111111111111111111111111111111111111111-11111111111111--11111111111111111111111111111111111111111111111111111111--111111111--1111111---11-------111111-11111111111111-------1-11111-111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111----------111111111111111111111111111111111111111111111111111111111--11111111111111111---------------------------1111111111--- 11--11--311-------------------------------------------------------------------------------------------------21------------------------------------------------1----------------1111B111-11-----2113111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 181 STR:RPRED 98.9 SQ:SECSTR HHHHHcccEEEcEETTEEEEEEcccEEETTEEEEcccccEEEETTTTEEEEEEccHHHHHHHHHHHHHHHHTTTTcHHHHHHHHHHHHHcTHHHHHcccEEEEEEcccEEEEETTTEEEHccTTccEEEcTTHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcTTcccccEEEEEEcc## PSIPRED cccccccEEEEEEEccEEEEEEcccccHHHHHHcccccEEEEEcccEEEEEEcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHEEccccEEEEEEccccEEccccccEEEEEccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccEEEEEEccccc //