Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : iglC2
DDBJ      :iglC2        intracellular growth locus protein C

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:209 amino acids
:BLT:PDB   5->207 2qwuA PDBj e-100 99.0 %
:RPS:PFM   1->209 PF11550 * IglC 2e-93 99.5 %
:HMM:PFM   1->209 PF11550 * IglC 2.1e-144 96.2 209/211  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31492.1 GT:GENE iglC2 GT:PRODUCT intracellular growth locus protein C GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1843735..1844364) GB:FROM 1843735 GB:TO 1844364 GB:DIRECTION - GB:GENE iglC2 GB:PRODUCT intracellular growth locus protein C GB:PROTEIN_ID ACD31492.1 GB:DB_XREF GI:187713195 GB:GENE:GENE iglC2 LENGTH 209 SQ:AASEQ MSEMITRQQVTSGETIHVRTDPTACIGSHPNCRLFIDSLTIAGEKLDKNIVAIEGGEDVTKADSATAAASVIRLSITPGSINPTISITLGVLIKSNVRTKIEEKVSSILQASATDMKIKLGNSNKKQEYKTDEAWGIMIDLSNLELYPISAKAFSISIEPTELMGVSKDGMSYHIISIDGLTTSQGSLPVCCAASTDKGVAKIGYIAAA GT:EXON 1|1-209:0| BL:PDB:NREP 1 BL:PDB:REP 5->207|2qwuA|e-100|99.0|197/199| RP:PFM:NREP 1 RP:PFM:REP 1->209|PF11550|2e-93|99.5|209/209|IglC| HM:PFM:NREP 1 HM:PFM:REP 1->209|PF11550|2.1e-144|96.2|209/211|IglC| OP:NHOMO 16 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------122221222---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 197 STR:RPRED 94.3 SQ:SECSTR ####ccHHHHHHTccEEEEccTTTTcccccccc#EEccEEETTEEcccccccccTTccGGGcccccccEEEEE#EEEccccccEEEEEEEEEEcHHHHHHHHHHHHHHHHHHGGG#cEEEcccccccEEcTTccEEc#cccTTcEEEEccTTTcEEEEEEccT#cccTTc#EEEEEEEEEEEccccEEEEEcccTTcEEEEEccccc## DISOP:02AL 67-67,118-118,123-123,137-137,143-143,146-146,151-151| PSIPRED ccHHHHHHHcccccEEEEEccccHHcccccccEEEEEEEEEccccccccEEEEEcccccccccccccEEEEEEEEEcccccccEEEEEEEEEEEcccHHHHHHHHHHHHHccccEEEEEEcccccccEEcccccEEEEEEccccEEEEEEccEEEEEEcHHHHEEEcccccEEEEEEEEEEEccccccEEEEEcccccccEEEEEEEcc //