[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ilvN
DDBJ      :ilvN         acetolactate synthase, small subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.18
:105 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   13->77 2f1fB PDBj 2e-04 27.7 %
:RPS:PDB   1->79 3dc2B PDBj 6e-10 11.4 %
:RPS:SCOP  6->76 2f1fA1  d.58.18.6 * 8e-11 26.8 %
:HMM:SCOP  5->80 2f1fA1 d.58.18.6 * 3.1e-11 26.3 %
:HMM:PFM   18->71 PF01842 * ACT 7.2e-07 17.0 53/66  
:BLT:SWISS 6->83 ILVH_AQUAE 3e-08 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31090.1 GT:GENE ilvN GT:PRODUCT acetolactate synthase, small subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1300644..1300961) GB:FROM 1300644 GB:TO 1300961 GB:DIRECTION - GB:GENE ilvN GB:PRODUCT acetolactate synthase, small subunit GB:PROTEIN_ID ACD31090.1 GB:DB_XREF GI:187712793 GB:GENE:GENE ilvN LENGTH 105 SQ:AASEQ MSENIYFITMNTENTLCVLQRISSVLSRNRINIEQLTVFETANKGISHFNLVVHSTQDKIEKIVRKLANVIEVIDISITNCLPIQGTVVSEVPQNVKTASQRKAA GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 6->83|ILVH_AQUAE|3e-08|33.3|78/192| BL:PDB:NREP 1 BL:PDB:REP 13->77|2f1fB|2e-04|27.7|65/158| RP:PDB:NREP 1 RP:PDB:REP 1->79|3dc2B|6e-10|11.4|79/523| HM:PFM:NREP 1 HM:PFM:REP 18->71|PF01842|7.2e-07|17.0|53/66|ACT| RP:SCP:NREP 1 RP:SCP:REP 6->76|2f1fA1|8e-11|26.8|71/76|d.58.18.6| HM:SCP:REP 5->80|2f1fA1|3.1e-11|26.3|76/0|d.58.18.6|1/1|ACT-like| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 83 STR:RPRED 79.0 SQ:SECSTR EEcccEEEEEEEEccTTHHHHHHHHHHHTTccEEEEEEEEcccccEEEEEEEEccccHHHHHHHHHHHTccEEEEEEcccccG###################### PSIPRED ccccEEEEEEEEcccccHHHHHHHHHHcccEEEEEEEEEccccccEEEEEEEEEccHHHHHHHHHHHHccccEEEEEEccccEEEEEEEEEEEcccccHHHHHcc //