[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : infA
DDBJ      :infA         translation initiation factor IF-1
Swiss-Prot:IF1_FRATT    RecName: Full=Translation initiation factor IF-1;

Homologs  Archaea  0/68 : Bacteria  882/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:72 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->72 1ah9A PDBj 3e-31 84.5 %
:RPS:PDB   2->72 1ah9A PDBj 1e-19 84.5 %
:RPS:SCOP  1->70 1jt8A  b.40.4.5 * 3e-19 23.2 %
:HMM:SCOP  1->71 1hr0W_ b.40.4.5 * 1.1e-29 67.6 %
:RPS:PFM   5->70 PF01176 * eIF-1a 2e-21 74.2 %
:HMM:PFM   6->70 PF01176 * eIF-1a 3.8e-30 50.0 64/65  
:BLT:SWISS 1->72 IF1_FRATT 2e-37 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30906.1 GT:GENE infA GT:PRODUCT translation initiation factor IF-1 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1066056..1066274) GB:FROM 1066056 GB:TO 1066274 GB:DIRECTION - GB:GENE infA GB:PRODUCT translation initiation factor IF-1 GB:PROTEIN_ID ACD30906.1 GB:DB_XREF GI:187712609 GB:GENE:GENE infA LENGTH 72 SQ:AASEQ MAKEDCIEMEGVVLEALPNTMFRVELENGRIVTAHISGKMRKNYIRILTGDKVVVEITPYDLTKGRIKFRSK GT:EXON 1|1-72:0| SW:ID IF1_FRATT SW:DE RecName: Full=Translation initiation factor IF-1; SW:GN Name=infA; OrderedLocusNames=FTT0966; SW:KW Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->72|IF1_FRATT|2e-37|100.0|72/72| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003743|"GO:translation initiation factor activity"|Initiation factor| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 2->72|1ah9A|3e-31|84.5|71/71| RP:PDB:NREP 1 RP:PDB:REP 2->72|1ah9A|1e-19|84.5|71/71| RP:PFM:NREP 1 RP:PFM:REP 5->70|PF01176|2e-21|74.2|66/66|eIF-1a| HM:PFM:NREP 1 HM:PFM:REP 6->70|PF01176|3.8e-30|50.0|64/65|eIF-1a| GO:PFM:NREP 3 GO:PFM GO:0003723|"GO:RNA binding"|PF01176|IPR006196| GO:PFM GO:0003743|"GO:translation initiation factor activity"|PF01176|IPR006196| GO:PFM GO:0006413|"GO:translational initiation"|PF01176|IPR006196| RP:SCP:NREP 1 RP:SCP:REP 1->70|1jt8A|3e-19|23.2|69/102|b.40.4.5| HM:SCP:REP 1->71|1hr0W_|1.1e-29|67.6|71/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 973 OP:NHOMOORG 893 OP:PATTERN -------------------------------------------------------------------- 1111211111111111111-11111111111111111111111111111111111111111111111211111111111111111111111-111111111111111111111111111111111111111111111111111111111111111--------111111111--1-----1--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1112111111111111111111111111111211111111111111111111111111111-11111111111-111111111111111111111111111111111111111111111-1111111111111111111111111111222122222233232321112222222221222333312222212332121111112222221-1111111122211111112112222-11111111122221111111111111111111111111111111111111111111111111111111111111111111211111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111112111111111111111111-1111111---1-11111111111111-11121 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------1-1-2-1111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 100.0 SQ:SECSTR ccccccEEccEEEEEEccccEEEEEETTccEEEEEEcccGGGTTccccTTcEEccEEccccTTEEEEccccc PSIPRED cccccEEEEEEEEEEEccccEEEEEEccccEEEEEEcccEEEEEEEEccccEEEEEEccccccccEEEEEEc //