[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : infC
DDBJ      :infC         translation initiation factor IF-3
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  877/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
d.15.8d.68.1
:170 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   7->63 1tifA PDBj 7e-10 43.9 %
:BLT:PDB   87->170 1ife- PDBj 1e-29 69.0 %
:RPS:PDB   87->167 2crqA PDBj 2e-18 18.5 %
:RPS:SCOP  3->68 1tifA  d.15.8.1 * 5e-16 43.9 %
:RPS:SCOP  87->169 1tigA  d.68.1.1 * 2e-30 51.8 %
:HMM:SCOP  3->78 1tifA_ d.15.8.1 * 1.5e-27 59.2 %
:HMM:SCOP  82->171 2ifeA_ d.68.1.1 * 5.4e-34 62.2 %
:RPS:PFM   7->68 PF05198 * IF3_N 5e-11 50.0 %
:RPS:PFM   87->167 PF00707 * IF3_C 4e-22 66.7 %
:HMM:PFM   82->169 PF00707 * IF3_C 7.6e-39 61.4 88/88  
:HMM:PFM   3->77 PF05198 * IF3_N 2.3e-33 60.0 75/76  
:BLT:SWISS 4->170 IF3_AZOVI 5e-51 67.1 %
:PROS 58->71|PS00938|IF3
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30932.1 GT:GENE infC GT:PRODUCT translation initiation factor IF-3 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1098192..1098704) GB:FROM 1098192 GB:TO 1098704 GB:DIRECTION - GB:GENE infC GB:PRODUCT translation initiation factor IF-3 GB:PROTEIN_ID ACD30932.1 GB:DB_XREF GI:187712635 GB:GENE:GENE infC LENGTH 170 SQ:AASEQ MDKKAPINEQIKAKEVRLVGVDGQQIGVVSINEALALAEEADVDLVEMVANANPPVCRLMDYGKYLFEQGKKRAQAKKNQKQTQVKEVKLRPVTDVGDYQVKLRNLIKFLEKGDKVKVTLRFRGREMSHKELGMEMLQRMANDAAEYGVVEHQPKLEGRQMIMVLGPKKK GT:EXON 1|1-170:0| BL:SWS:NREP 1 BL:SWS:REP 4->170|IF3_AZOVI|5e-51|67.1|167/181| PROS 58->71|PS00938|IF3|PDOC00723| SEG 33->47|ealalaeeadvdlve| SEG 69->86|qgkkraqakknqkqtqvk| BL:PDB:NREP 2 BL:PDB:REP 7->63|1tifA|7e-10|43.9|57/76| BL:PDB:REP 87->170|1ife-|1e-29|69.0|84/91| RP:PDB:NREP 1 RP:PDB:REP 87->167|2crqA|2e-18|18.5|81/112| RP:PFM:NREP 2 RP:PFM:REP 7->68|PF05198|5e-11|50.0|62/74|IF3_N| RP:PFM:REP 87->167|PF00707|4e-22|66.7|81/87|IF3_C| HM:PFM:NREP 2 HM:PFM:REP 82->169|PF00707|7.6e-39|61.4|88/88|IF3_C| HM:PFM:REP 3->77|PF05198|2.3e-33|60.0|75/76|IF3_N| GO:PFM:NREP 4 GO:PFM GO:0003743|"GO:translation initiation factor activity"|PF05198|IPR019814| GO:PFM GO:0006413|"GO:translational initiation"|PF05198|IPR019814| GO:PFM GO:0003743|"GO:translation initiation factor activity"|PF00707|IPR019815| GO:PFM GO:0006413|"GO:translational initiation"|PF00707|IPR019815| RP:SCP:NREP 2 RP:SCP:REP 3->68|1tifA|5e-16|43.9|66/76|d.15.8.1| RP:SCP:REP 87->169|1tigA|2e-30|51.8|83/88|d.68.1.1| HM:SCP:REP 3->78|1tifA_|1.5e-27|59.2|76/76|d.15.8.1|1/1|Translation initiation factor IF3, N-terminal domain| HM:SCP:REP 82->171|2ifeA_|5.4e-34|62.2|90/0|d.68.1.1|1/1|Translation initiation factor IF3, C-terminal domain| OP:NHOMO 918 OP:NHOMOORG 897 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111112211111111111111111112211111111111111111111111111111111111111111111-111111111111111112211111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111113111111111111111111111111111111111111111111-111111111111111111111111111-1111111111111111111111111111111-111111111111111111111112211111111111111111111111111111111111111111-111111111111111111111-1111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--111--1111111111111111111-11-11-111----1--11111-11111111111111111111111111111111-11111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111-11111-1111111111111111111111111111111111111111111-111-1-----11--1-1111111111111111 ------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------2--1-11117111112112-211------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 82.9 SQ:SECSTR ######cGGGccccEEEEEcTTccEEEEEEHHHHHHHHHHTTcEEEEEETTccccEEEEEcHH#######################EEEEETTccHHHHHHHHHHHHHHHHTTcEEEEEEEccTTccccHHHHHHHHHHHHTTcTTTcEEEEEEEEGGTEEEEEEEcccc PSIPRED ccccccccccccccEEEEEcccccEEccccHHHHHHHHHHccccEEEEcccccccEEEEEcHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHEEccccccccEEEEEEEEccc //