[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : kpsF
DDBJ      :kpsF         phosphosugar isomerase
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  567/915 : Eukaryota  76/199 : Viruses  1/175   --->[See Alignment]
c.80.1d.37.1
:323 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->192 3fxaA PDBj 7e-25 32.6 %
:BLT:PDB   193->257 3fnaA PDBj 2e-12 53.2 %
:BLT:PDB   271->317 2p9mD PDBj 2e-05 41.3 %
:RPS:PDB   15->322 2cb0A PDBj 8e-37 17.3 %
:RPS:SCOP  44->188 1tzbA  c.80.1.1 * 5e-32 26.5 %
:RPS:SCOP  212->320 3ddjA2  d.37.1.1 * 3e-20 28.7 %
:HMM:SCOP  2->322 1j5xA_ c.80.1.1 * 3.3e-62 32.6 %
:RPS:PFM   43->171 PF01380 * SIS 1e-12 36.5 %
:RPS:PFM   214->321 PF00478 * IMPDH 2e-05 35.8 %
:HMM:PFM   43->172 PF01380 * SIS 2.3e-31 32.3 127/131  
:HMM:PFM   201->254 PF00571 * CBS 3e-08 30.8 52/57  
:HMM:PFM   267->320 PF00571 * CBS 1e-13 33.3 54/57  
:BLT:SWISS 8->322 Y1546_AQUAE 3e-85 53.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30959.1 GT:GENE kpsF GT:PRODUCT phosphosugar isomerase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1128869..1129840 GB:FROM 1128869 GB:TO 1129840 GB:DIRECTION + GB:GENE kpsF GB:PRODUCT phosphosugar isomerase GB:PROTEIN_ID ACD30959.1 GB:DB_XREF GI:187712662 GB:GENE:GENE kpsF LENGTH 323 SQ:AASEQ MTSHINNAVETFRLEIETLEKLKNSIDENFEKACEIILENNRDKSRVIITGMGKSGHIGKKMAATFASTGTPAFFVHPGEAGHGDFGMITKNDVLIAISNSGTSSEIMGLLPMIKHLDIPIIAITSNPKSILARNSNVTLNLHVDKEACPLNLAPTSSTTATLVLGDALAIALLKAKNFSEKDFAFSHPNGALGRKLILKVENIMRKGNEIPIVKPTDNIRKAILEISDKGVGNTLVAENNTLLGIFTDGDLRRMFEAESFNSQRAISEVMTKNPKSISKEEMAITALEKMEKYEITSLAVVDNGHNILGIVTMHDLIKLELR GT:EXON 1|1-323:0| BL:SWS:NREP 1 BL:SWS:REP 8->322|Y1546_AQUAE|3e-85|53.5|310/322| BL:PDB:NREP 3 BL:PDB:REP 5->192|3fxaA|7e-25|32.6|181/187| BL:PDB:REP 193->257|3fnaA|2e-12|53.2|62/112| BL:PDB:REP 271->317|2p9mD|2e-05|41.3|46/124| RP:PDB:NREP 1 RP:PDB:REP 15->322|2cb0A|8e-37|17.3|289/313| RP:PFM:NREP 2 RP:PFM:REP 43->171|PF01380|1e-12|36.5|126/131|SIS| RP:PFM:REP 214->321|PF00478|2e-05|35.8|95/459|IMPDH| HM:PFM:NREP 3 HM:PFM:REP 43->172|PF01380|2.3e-31|32.3|127/131|SIS| HM:PFM:REP 201->254|PF00571|3e-08|30.8|52/57|CBS| HM:PFM:REP 267->320|PF00571|1e-13|33.3|54/57|CBS| GO:PFM:NREP 4 GO:PFM GO:0005529|"GO:sugar binding"|PF01380|IPR001347| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01380|IPR001347| GO:PFM GO:0003824|"GO:catalytic activity"|PF00478|IPR001093| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00478|IPR001093| RP:SCP:NREP 2 RP:SCP:REP 44->188|1tzbA|5e-32|26.5|136/301|c.80.1.1| RP:SCP:REP 212->320|3ddjA2|3e-20|28.7|108/132|d.37.1.1| HM:SCP:REP 2->322|1j5xA_|3.3e-62|32.6|291/329|c.80.1.1|1/1|SIS domain| OP:NHOMO 796 OP:NHOMOORG 662 OP:PATTERN ---1-1-11111111-----1--1---------1-1----------------1-11--------1--- 111-----111----------------------111---------1--------------------------------1----112111111-111---1111112111111111111111111111111111111----------1--1-----11111-11-------1-1-----1-----------1--------11-1-1-111--------1-------11111-----------------------1---------1-----1----11----------------------------------------------------1111111-1--2---11--2--------------1--------11111111111111--1111111111111111111111-1111111111111111111111331111111111111111111111111111111------------1111111111111----1-12-111111211112111111121222222211211211111111221111211111111121111111---12111111111--1211111121111111111-11111111111111111111111111111112111112221111111211112111111--11111------21111212224244422-2222434222243322332222111112222222222222222331222221122222222222211111111111111111111211111111111111111111111111111111121221111111111111112111111111211111111111111111111111111------------------------------------------1---111 ---------------111111111111111111-1-1-1-11111111111111-1111111111111-1--111-----111111------1-------1-1111----------------------------------------------------------------1--1---------1121-3211--1--1- ---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 322 STR:RPRED 99.7 SQ:SECSTR HHHHHHTHHHHHHHHHTTHHHHHHHHHHHHHHHTTTcHHHcccccEEEEEEcTHHHHHHHHHHHHHHHTTcEEEEEEHHHHHHHGGGccccccEEEEEccccccHHHHHHHHTccccEEEEEccccHTTcHHHHTccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHTTHHHHHHHHHHccccEEEEEEcTTHHHHHHHHHHHcccEEEEEGGGGTTGGGGccTTEEEEEEccccHHHHHHHHHHHHTTcEEEEEEcTTcccccccccEEEEcccccTTGTTTTTHHHHHHHHHHHH# PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHccccEEEEEcccccHHHHHccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccccHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHccccEEEEEEccEEEEEEEHHHHHHHHHcccccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEEHHHHHHcccc //