[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : lgt
DDBJ      :lgt          prolipoprotein diacylglyceryl transferase
Swiss-Prot:LGT_FRATM    RecName: Full=Prolipoprotein diacylglyceryl transferase;         EC=2.4.99.-;

Homologs  Archaea  0/68 : Bacteria  747/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:268 amino acids
:PSIPRED
:RPS:PFM   9->254 PF01790 * LGT 3e-49 49.4 %
:HMM:PFM   7->255 PF01790 * LGT 1.1e-88 48.1 241/257  
:BLT:SWISS 1->268 LGT_FRATM e-153 100.0 %
:PROS 139->151|PS01311|LGT
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30693.1 GT:GENE lgt GT:PRODUCT prolipoprotein diacylglyceryl transferase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(780830..781636) GB:FROM 780830 GB:TO 781636 GB:DIRECTION - GB:GENE lgt GB:PRODUCT prolipoprotein diacylglyceryl transferase GB:PROTEIN_ID ACD30693.1 GB:DB_XREF GI:187712396 GB:GENE:GENE lgt LENGTH 268 SQ:AASEQ MLQYPHINPVALQLGPIKIHWYGLMYLLGIFAGWYLTRYRAKVKPWAPIKPEQVGDLTFYVALGVILGGRIGYIIFYNLPYYFHNPSQMFFLWDGGMSFHGGFIGVLIAFALFARKIGANFFDLGEFIAPVIPIGLGAGRIGNFINGELWGKVTDSPLGMVFPTGGPLPRYPSQLFEFFFEGVVLFSVLWLVTIKKRPRYLVLGLFMFLYGCARFICEFFRQPDPQYGYIFFNWMTMGQILSIPMILLGAVILIAVFIKTRKNKCENI GT:EXON 1|1-268:0| SW:ID LGT_FRATM SW:DE RecName: Full=Prolipoprotein diacylglyceryl transferase; EC=2.4.99.-; SW:GN Name=lgt; OrderedLocusNames=FTM_0715; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Transferase; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->268|LGT_FRATM|e-153|100.0|268/268| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 139->151|PS01311|LGT|PDOC01015| TM:NTM 7 TM:REGION 17->38| TM:REGION 57->79| TM:REGION 97->114| TM:REGION 120->142| TM:REGION 173->194| TM:REGION 199->221| TM:REGION 238->259| SEG 175->189|lfefffegvvlfsvl| RP:PFM:NREP 1 RP:PFM:REP 9->254|PF01790|3e-49|49.4|237/251|LGT| HM:PFM:NREP 1 HM:PFM:REP 7->255|PF01790|1.1e-88|48.1|241/257|LGT| GO:PFM:NREP 4 GO:PFM GO:0009249|"GO:protein lipoylation"|PF01790|IPR001640| GO:PFM GO:0016020|"GO:membrane"|PF01790|IPR001640| GO:PFM GO:0016757|"GO:transferase activity, transferring glycosyl groups"|PF01790|IPR001640| GO:PFM GO:0042158|"GO:lipoprotein biosynthetic process"|PF01790|IPR001640| OP:NHOMO 776 OP:NHOMOORG 748 OP:PATTERN -------------------------------------------------------------------- -11-1--------------------------------1----------1------1----11-1----111-1111111111---111111211111--111111-111-1111111111----111111111211-1111---1-11111111-111--1--11111111--11---1-1-----1111-11111111121-1121111111--1111--1-1-------1-11111111111111111111-11-11-11--111111111---12111111111111111111111111111111111111111111111-1213111111111-1111111-1--1111-1-211211221-1111111-1-111111111111111111111111111111111-111112111111111111111111111113111111111111111111111-1111111111111--11111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111-2111211111111111111111-1111111111111111111111111111111111211111122222111111211112111-11111-1-11111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111221111111111111111111111111111111111111111111111111111111111111------1111111-111---------------------1---1111111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccHHHHEEEEccHHHHHHcHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccc //