[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : lolB
DDBJ      :lolB         outer membrane lipoprotein LolB
Swiss-Prot:LOLB_FRATN   RecName: Full=Outer-membrane lipoprotein lolB;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  177/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.125.1
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   59->212 1iwmA PDBj 7e-15 28.5 %
:HMM:SCOP  30->215 1iwmA_ b.125.1.2 * 3.6e-45 32.0 %
:RPS:PFM   60->212 PF03550 * LolB 2e-23 33.1 %
:HMM:PFM   59->212 PF03550 * LolB 9.9e-39 32.9 152/157  
:BLT:SWISS 5->214 LOLB_FRATN e-100 99.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31407.1 GT:GENE lolB GT:PRODUCT outer membrane lipoprotein LolB GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1704233..1704877 GB:FROM 1704233 GB:TO 1704877 GB:DIRECTION + GB:GENE lolB GB:PRODUCT outer membrane lipoprotein LolB GB:PROTEIN_ID ACD31407.1 GB:DB_XREF GI:187713110 GB:GENE:GENE lolB LENGTH 214 SQ:AASEQ MLNTMSKLKIDTKRRFSLLIALVLIISLSSCATTQTNVTAITTKTVFNQETTYHNLLKLKKWQANGVIGIIYDNQAESANYTYLQDGDNFSIKLYGPLGIGSIEIKGDTNSVSLANSKGQKLTAKDAKTLMLEQLGWCVPVEGLKYWIKAIAIPNIRQTSELNTNNLLSKLSQNGWSISYSNYQLVDSKYPLPTKIRMSRDNLTLKIVIKSWQI GT:EXON 1|1-214:0| SW:ID LOLB_FRATN SW:DE RecName: Full=Outer-membrane lipoprotein lolB;Flags: Precursor; SW:GN Name=lolB; OrderedLocusNames=FTN_0145; SW:KW Cell membrane; Cell outer membrane; Chaperone; Complete proteome;Lipoprotein; Membrane; Palmitate; Protein transport; Signal;Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 5->214|LOLB_FRATN|e-100|99.5|210/210| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0009279|"GO:cell outer membrane"|Cell outer membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 1 TM:REGION 16->35| SEG 17->30|sllialvliislss| SEG 33->45|ttqtnvtaittkt| BL:PDB:NREP 1 BL:PDB:REP 59->212|1iwmA|7e-15|28.5|151/177| RP:PFM:NREP 1 RP:PFM:REP 60->212|PF03550|2e-23|33.1|151/152|LolB| HM:PFM:NREP 1 HM:PFM:REP 59->212|PF03550|9.9e-39|32.9|152/157|LolB| GO:PFM:NREP 2 GO:PFM GO:0009279|"GO:cell outer membrane"|PF03550|IPR004565| GO:PFM GO:0015031|"GO:protein transport"|PF03550|IPR004565| HM:SCP:REP 30->215|1iwmA_|3.6e-45|32.0|172/177|b.125.1.2|1/1|Prokaryotic lipoproteins and lipoprotein localization factors| OP:NHOMO 177 OP:NHOMOORG 177 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------1-----1---------------1-11111--------111-1------------------------------------------------------------111-111-1-1----------------------1111------1111-1-1111111111-1111111111111111111111-----111111111111111111111111---11111111111----11111111111111---1-1--111----11111111111111111111111111111111111111-111-111111-1111111111111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 151 STR:RPRED 70.6 SQ:SECSTR ##########################################################ccEEEEEEEEEEEccccEEEEEEEEEEETTEEEEEEEcTTccEEEEEEEETTEEEEEcTTccEEEEccHHHHHHHHHcccccHHHHHHHT##TTccTTcccEEEcTTccEEEEEcccEEEEEccEE#TTccccEEcEEEEEccccEEEEEEEEE## DISOP:02AL 214-215| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccEEEEEEEEEEEccccEEEEEEEEEccccEEEEEEcccccEEEEEEEcccEEEEEEccccEEEcccHHHHHHHHHcccccHHHHHHHHHcccccccccEEEEcccccEEEEEEccEEEEEEEcccccccccccEEEEEEcccEEEEEEEEEEEc //