[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : minC
DDBJ      :minC         septum formation inhibitor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  254/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.80.3
:228 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->107 3ghfA PDBj 1e-05 29.0 %
:BLT:PDB   104->228 1hf2B PDBj 2e-07 32.2 %
:HMM:SCOP  119->228 1hf2A1 b.80.3.1 * 1.1e-26 41.2 %
:RPS:PFM   1->101 PF05209 * MinC_N 7e-08 28.0 %
:RPS:PFM   121->207 PF03775 * MinC_C 4e-11 40.5 %
:HMM:PFM   121->226 PF03775 * MinC_C 1.5e-33 50.0 102/105  
:HMM:PFM   1->101 PF05209 * MinC_N 6.3e-12 22.8 92/99  
:BLT:SWISS 8->196 MINC_VIBHB 3e-27 39.2 %
:BLT:SWISS 173->226 PGK_PICPA 5e-04 37.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30364.1 GT:GENE minC GT:PRODUCT septum formation inhibitor GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 343347..344033 GB:FROM 343347 GB:TO 344033 GB:DIRECTION + GB:GENE minC GB:PRODUCT septum formation inhibitor GB:PROTEIN_ID ACD30364.1 GB:DB_XREF GI:187712067 GB:GENE:GENE minC LENGTH 228 SQ:AASEQ MKQAFHFKGGNYTISAININVTEFTQIESLLNSKISQSKSFFHNTPFAIDIRDIDEDEKCSVNFLEKVIATFKANGMIPVGFVVNNKELKIKLARAGHNILKGGKSKEVNVDEDKSFTSAKIVTTPVRTGQSINARDCDVIVTANVNNGAEIIADGSIIVYGRIGGRVIAGSSGNKDAKIICKDLRAELVSIAGKYVTLNNESIPVENTNTDGYIVYLQDDKIHIEGF GT:EXON 1|1-228:0| BL:SWS:NREP 2 BL:SWS:REP 8->196|MINC_VIBHB|3e-27|39.2|181/220| BL:SWS:REP 173->226|PGK_PICPA|5e-04|37.0|54/416| SEG 156->169|gsiivygriggrvi| BL:PDB:NREP 2 BL:PDB:REP 8->107|3ghfA|1e-05|29.0|93/100| BL:PDB:REP 104->228|1hf2B|2e-07|32.2|115/206| RP:PFM:NREP 2 RP:PFM:REP 1->101|PF05209|7e-08|28.0|93/99|MinC_N| RP:PFM:REP 121->207|PF03775|4e-11|40.5|84/104|MinC_C| HM:PFM:NREP 2 HM:PFM:REP 121->226|PF03775|1.5e-33|50.0|102/105|MinC_C| HM:PFM:REP 1->101|PF05209|6.3e-12|22.8|92/99|MinC_N| GO:PFM:NREP 1 GO:PFM GO:0051302|"GO:regulation of cell division"|PF05209|IPR007874| HM:SCP:REP 119->228|1hf2A1|1.1e-26|41.2|102/0|b.80.3.1|1/1|Cell-division inhibitor MinC, C-terminal domain| OP:NHOMO 259 OP:NHOMOORG 258 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1--------------------1---1111-1111111-------1----------------------------------------------------------111111111111----1111------111---------1----11111111-1-----111111111--11----1-1----------------------11--------------------------1111111-1-11111111111111111111111-111-111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111------111111111----------------------111-11111111111111111111111111111111111111111111111111111111----------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------21-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 209 STR:RPRED 91.7 SQ:SECSTR #######cccccccEEEEEEcccHHHHHHHHHHHHHHcHHHHTTcEEEEEEEEcccccc#cccHHHHHHH##ETTTcEEEEEEcccHHHHHHHHHHTccEEEETEEEEEEEEEEEEcccccEEcccccTTcEEcEEcccEEEcccccTTcEEEEcccEEEEEEEccEEEEcTTTcTTccEEEEEEcccEEEETT#EEEcccTTcc########EEEEEETTEEEEEEG DISOP:02AL 228-229| PSIPRED ccccEEEEcccccEEEEEEccccHHHHHHHHHHHHHHHHHHHcccEEEEEEHHccccccccHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHcccccccccccccccccccccccccEEEEcccccccEEEEccccEEEEcccccccEEEEcccEEEEEEEccEEEEcccccccEEEEEEccccEEEEEccEEEEcccccccHHHcccccEEEEEEccEEEEEEc //