[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : minE
DDBJ      :minE         cell division topological specificity factor protein
Swiss-Prot:MINE_FRATW   RecName: Full=Cell division topological specificity factor;

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1d.71.1
:90 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  18->58 1qhh.1  c.37.1.19 * 8e-04 22.0 %
:RPS:SCOP  41->87 1ev0A  d.71.1.1 * 6e-04 31.8 %
:HMM:SCOP  37->89 1ev0A_ d.71.1.1 * 2.2e-05 38.0 %
:RPS:PFM   14->88 PF03776 * MinE 1e-08 53.8 %
:HMM:PFM   14->89 PF03776 * MinE 3.3e-25 54.4 68/70  
:BLT:SWISS 1->90 MINE_FRATW 3e-45 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30366.1 GT:GENE minE GT:PRODUCT cell division topological specificity factor protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 344900..345172 GB:FROM 344900 GB:TO 345172 GB:DIRECTION + GB:GENE minE GB:PRODUCT cell division topological specificity factor protein GB:PROTEIN_ID ACD30366.1 GB:DB_XREF GI:187712069 GB:GENE:GENE minE LENGTH 90 SQ:AASEQ MLAKLFGLSKKQQSASVAKERLQIIVAHQRSELHPRSSKISSHLLAELKDEIIEVVKKYVALSEENIRDIDLKVEDSSKNSTIEVNIPFN GT:EXON 1|1-90:0| SW:ID MINE_FRATW SW:DE RecName: Full=Cell division topological specificity factor; SW:GN Name=minE; OrderedLocusNames=FTW_0327; SW:KW Cell cycle; Cell division; Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->90|MINE_FRATW|3e-45|100.0|90/90| GO:SWS:NREP 2 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| RP:PFM:NREP 1 RP:PFM:REP 14->88|PF03776|1e-08|53.8|65/68|MinE| HM:PFM:NREP 1 HM:PFM:REP 14->89|PF03776|3.3e-25|54.4|68/70|MinE| GO:PFM:NREP 2 GO:PFM GO:0032955|"GO:regulation of barrier septum formation"|PF03776|IPR005527| GO:PFM GO:0051301|"GO:cell division"|PF03776|IPR005527| RP:SCP:NREP 2 RP:SCP:REP 18->58|1qhh.1|8e-04|22.0|41/623|c.37.1.19| RP:SCP:REP 41->87|1ev0A|6e-04|31.8|44/58|d.71.1.1| HM:SCP:REP 37->89|1ev0A_|2.2e-05|38.0|50/58|d.71.1.1|1/1|Cell division protein MinE topological specificity domain| OP:NHOMO 42 OP:NHOMOORG 42 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------11-1--------11--------1-1-1--------------1--------11-------------------------------------------1----------------------------11--------------11-----------1---------------------------------------------------------------------------------------------------------------1---------------------------1-11111111-1111----111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 90-91| PSIPRED ccHHHHcccccccHHHHHHHHHHHEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEccccEEEEEEEcccc //