[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : mutM
DDBJ      :mutM         Formamidopyrimidine-DNA glycosylase
Swiss-Prot:FPG_FRATT    RecName: Full=Formamidopyrimidine-DNA glycosylase;         Short=Fapy-DNA glycosylase;         EC=3.2.2.23;AltName: Full=DNA-(apurinic or apyrimidinic site) lyase mutM;         Short=AP lyase mutM;         EC=4.2.99.18;

Homologs  Archaea  0/68 : Bacteria  724/915 : Eukaryota  29/199 : Viruses  0/175   --->[See Alignment]
a.156.1b.113.1g.39.1
:274 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->274 1k82A PDBj 6e-52 43.2 %
:RPS:PDB   2->274 1ee8A PDBj 4e-72 33.7 %
:RPS:SCOP  2->131 1k3wA2  b.113.1.1 * 4e-30 19.8 %
:RPS:SCOP  135->222 1ee8A1  a.156.1.2 * 4e-29 37.5 %
:RPS:SCOP  223->274 1ee8A3  g.39.1.8 * 2e-21 36.5 %
:HMM:SCOP  2->125 1tdhA2 b.113.1.1 * 1.2e-35 38.1 %
:HMM:SCOP  135->228 1r2zA1 a.156.1.2 * 1.2e-27 39.4 %
:HMM:SCOP  222->274 1ee8A3 g.39.1.8 * 1.5e-16 39.6 %
:RPS:PFM   2->115 PF01149 * Fapy_DNA_glyco 1e-15 34.2 %
:RPS:PFM   135->222 PF06831 * H2TH 1e-17 42.0 %
:RPS:PFM   247->274 PF06827 * zf-FPG_IleRS 3e-04 46.4 %
:HMM:PFM   2->117 PF01149 * Fapy_DNA_glyco 7e-31 36.8 114/116  
:HMM:PFM   135->223 PF06831 * H2TH 3.2e-26 37.1 89/93  
:HMM:PFM   251->274 PF06827 * zf-FPG_IleRS 2.9e-08 37.5 24/30  
:BLT:SWISS 1->274 FPG_FRATT e-148 99.6 %
:PROS 249->273|PS01242|ZF_FPG_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31227.1 GT:GENE mutM GT:PRODUCT Formamidopyrimidine-DNA glycosylase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1495235..1496059 GB:FROM 1495235 GB:TO 1496059 GB:DIRECTION + GB:GENE mutM GB:PRODUCT Formamidopyrimidine-DNA glycosylase GB:PROTEIN_ID ACD31227.1 GB:DB_XREF GI:187712930 GB:GENE:GENE mutM LENGTH 274 SQ:AASEQ MPELPEVETVKRGLIKTIIDKKIFDIEINTDKLRYPIDKDQLVKIKNKVVKEIQRRGKHLIIFIEDDLQLIIHLGMSGIIKVIDSTNYNKIKHDHIVVTLSDNLSLVYNDPRKFGYWLVNTNHTPLEHRVLVSHGVEPLTADFNSDYLVSKLKQTSRKIKQTIMDNNIVVGVGNIYASEALFDSNILPTRASNTITKKEAANLISSIKKILEKAITQGGTTLKDYKNTEGKPGYFTQQLNVYGRNEQQCYVCNTKIQSLVIAQRNTFFCKKCQK GT:EXON 1|1-274:0| SW:ID FPG_FRATT SW:DE RecName: Full=Formamidopyrimidine-DNA glycosylase; Short=Fapy-DNA glycosylase; EC=3.2.2.23;AltName: Full=DNA-(apurinic or apyrimidinic site) lyase mutM; Short=AP lyase mutM; EC=4.2.99.18; SW:GN Name=mutM; Synonyms=fpg; OrderedLocusNames=FTT0693c; SW:KW Complete proteome; DNA damage; DNA repair; DNA-binding; Glycosidase;Hydrolase; Lyase; Metal-binding; Multifunctional enzyme; Zinc;Zinc-finger. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->274|FPG_FRATT|e-148|99.6|274/274| GO:SWS:NREP 9 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0016798|"GO:hydrolase activity, acting on glycosyl bonds"|Glycosidase| GO:SWS GO:0008152|"GO:metabolic process"|Glycosidase| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| PROS 249->273|PS01242|ZF_FPG_1|PDOC00956| SEG 15->28|iktiidkkifdiei| BL:PDB:NREP 1 BL:PDB:REP 2->274|1k82A|6e-52|43.2|259/260| RP:PDB:NREP 1 RP:PDB:REP 2->274|1ee8A|4e-72|33.7|261/266| RP:PFM:NREP 3 RP:PFM:REP 2->115|PF01149|1e-15|34.2|114/118|Fapy_DNA_glyco| RP:PFM:REP 135->222|PF06831|1e-17|42.0|88/92|H2TH| RP:PFM:REP 247->274|PF06827|3e-04|46.4|28/30|zf-FPG_IleRS| HM:PFM:NREP 3 HM:PFM:REP 2->117|PF01149|7e-31|36.8|114/116|Fapy_DNA_glyco| HM:PFM:REP 135->223|PF06831|3.2e-26|37.1|89/93|H2TH| HM:PFM:REP 251->274|PF06827|2.9e-08|37.5|24/30|zf-FPG_IleRS| GO:PFM:NREP 11 GO:PFM GO:0003684|"GO:damaged DNA binding"|PF01149|IPR012319| GO:PFM GO:0003906|"GO:DNA-(apurinic or apyrimidinic site) lyase activity"|PF01149|IPR012319| GO:PFM GO:0006284|"GO:base-excision repair"|PF01149|IPR012319| GO:PFM GO:0008270|"GO:zinc ion binding"|PF01149|IPR012319| GO:PFM GO:0016799|"GO:hydrolase activity, hydrolyzing N-glycosyl compounds"|PF01149|IPR012319| GO:PFM GO:0003684|"GO:damaged DNA binding"|PF06831|IPR015886| GO:PFM GO:0003906|"GO:DNA-(apurinic or apyrimidinic site) lyase activity"|PF06831|IPR015886| GO:PFM GO:0006289|"GO:nucleotide-excision repair"|PF06831|IPR015886| GO:PFM GO:0008270|"GO:zinc ion binding"|PF06831|IPR015886| GO:PFM GO:0016799|"GO:hydrolase activity, hydrolyzing N-glycosyl compounds"|PF06831|IPR015886| GO:PFM GO:0003824|"GO:catalytic activity"|PF06827|IPR010663| RP:SCP:NREP 3 RP:SCP:REP 2->131|1k3wA2|4e-30|19.8|121/124|b.113.1.1| RP:SCP:REP 135->222|1ee8A1|4e-29|37.5|88/89|a.156.1.2| RP:SCP:REP 223->274|1ee8A3|2e-21|36.5|52/56|g.39.1.8| HM:SCP:REP 2->125|1tdhA2|1.2e-35|38.1|118/130|b.113.1.1|1/1|N-terminal domain of MutM-like DNA repair proteins| HM:SCP:REP 135->228|1r2zA1|1.2e-27|39.4|94/0|a.156.1.2|1/1|S13-like H2TH domain| HM:SCP:REP 222->274|1ee8A3|1.5e-16|39.6|53/56|g.39.1.8|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 853 OP:NHOMOORG 753 OP:PATTERN -------------------------------------------------------------------- 2321212222211132322-23113322222233333333121122111112223113--11322223432-----------3----------------1---1-1--11--------------1-----------11-1111111111111111111111111111111111121111121111111---111111111111111111211111111111111111111122111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111----------------------------1--112211111111-------2-21111111111111121111111111111111-1-1111111111111111111111111111111111111111111111111111111111-1111----1-1111111-11-1111111111111111111111111111111111111111111111111111111111111111111111111111111111---1111111111121211111112212-1--------------------------111111111111111111111111111111111-11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1-----111111111111111111111111-111111111111111111111111111111111111112111111111111111111111112222111-----------------111111-1111111111111111111-----------2- --------------1---------------------------------111-11--1-1111-----------------------------------------1----2-----------1----1---------------1-1--1------1-2-------1--------------1-1---23--1-21------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 273 STR:RPRED 99.6 SQ:SECSTR #ccHHHHHHHHHHHHHHHTTcEEEEEEEcccHcccTTTEEcGGGGTTEEEEEEEEETTEEEEEETTTEEEEEEcTTTcEEEccccTcccccTTEEEEEEEcccEEEEEEcTTcccEEEEEETTccTTcTHHHHccccTTcTTccHHHHHHHHHTccccHHHHHHHccccTTccHHHHHHHHHHTTccccccGGGccHHHHHHHHHHHHHHHHHHHHTTcccccccccTTccccccGGGcccTTcTTcccTTTccccEEEEccccEEEEcTTTTT DISOP:02AL 274-275| PSIPRED ccccHHHHHHHHHHHHHHcccEEEEEEEEcccccccccHHHHHHHcccEEEEEEEEEEEEEEEEccccEEEEEcccccEEEEEccccccccccEEEEEEEcccEEEEEEccccEEEEEEEEcccccccHHHHHcccccccccccHHHHHHHHccccccHHHHHHcccEEcccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEccccccccccccccEEEEEccccccccccccEEEEEEEccccEEEcccccc //