[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ndk
DDBJ      :ndk          nucleoside diphosphate kinase
Swiss-Prot:NDK_FRATM    RecName: Full=Nucleoside diphosphate kinase;         Short=NDK;         Short=NDP kinase;         EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase;

Homologs  Archaea  65/68 : Bacteria  798/915 : Eukaryota  194/199 : Viruses  1/175   --->[See Alignment]
d.58.6
:140 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->138 1nhkL PDBj 1e-49 65.9 %
:RPS:PDB   3->139 2cwkB PDBj 3e-55 46.7 %
:RPS:SCOP  1->138 1b4sA  d.58.6.1 * 3e-51 40.6 %
:HMM:SCOP  1->140 1w7wA_ d.58.6.1 * 2.1e-55 54.3 %
:RPS:PFM   4->135 PF00334 * NDK 4e-41 59.8 %
:HMM:PFM   4->138 PF00334 * NDK 5.1e-59 59.3 135/135  
:BLT:SWISS 1->140 NDK_FRATM 5e-76 100.0 %
:PROS 114->122|PS00469|NDP_KINASES

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30353.1 GT:GENE ndk GT:PRODUCT nucleoside diphosphate kinase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(325283..325705) GB:FROM 325283 GB:TO 325705 GB:DIRECTION - GB:GENE ndk GB:PRODUCT nucleoside diphosphate kinase GB:PROTEIN_ID ACD30353.1 GB:DB_XREF GI:187712056 GB:GENE:GENE ndk LENGTH 140 SQ:AASEQ MTKQRTLSIIKPDAVEKNVIGEIYSRFEKAGLRIIAAKMKHLSKAEAEGFYAVHKDRPFFSALVEFMISGPVIIQVLEGENAIAKNRELMGATNPKEAKAGTIRADFADSIDANAVHGSDAEDTAAQEIRYFFSDTEIFG GT:EXON 1|1-140:0| SW:ID NDK_FRATM SW:DE RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP kinase; EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase; SW:GN Name=ndk; OrderedLocusNames=FTM_0295; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase; Magnesium;Metal-binding; Nucleotide metabolism; Nucleotide-binding;Phosphoprotein; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->140|NDK_FRATM|5e-76|100.0|140/140| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0009117|"GO:nucleotide metabolic process"|Nucleotide metabolism| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 114->122|PS00469|NDP_KINASES|PDOC00409| BL:PDB:NREP 1 BL:PDB:REP 4->138|1nhkL|1e-49|65.9|135/143| RP:PDB:NREP 1 RP:PDB:REP 3->139|2cwkB|3e-55|46.7|137/152| RP:PFM:NREP 1 RP:PFM:REP 4->135|PF00334|4e-41|59.8|132/134|NDK| HM:PFM:NREP 1 HM:PFM:REP 4->138|PF00334|5.1e-59|59.3|135/135|NDK| GO:PFM:NREP 5 GO:PFM GO:0004550|"GO:nucleoside diphosphate kinase activity"|PF00334|IPR001564| GO:PFM GO:0005524|"GO:ATP binding"|PF00334|IPR001564| GO:PFM GO:0006183|"GO:GTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006228|"GO:UTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006241|"GO:CTP biosynthetic process"|PF00334|IPR001564| RP:SCP:NREP 1 RP:SCP:REP 1->138|1b4sA|3e-51|40.6|138/150|d.58.6.1| HM:SCP:REP 1->140|1w7wA_|2.1e-55|54.3|140/0|d.58.6.1|1/1|Nucleoside diphosphate kinase, NDK| OP:NHOMO 1682 OP:NHOMOORG 1058 OP:PATTERN 11-1111111111111-11111111111111111111111111111111111111111111111-111 1111111111111111111-111111111111111111111111111111111111111111111111111--------111111111111111--1--1-111111111111111111111112111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111113111111111111111111111-1-11-1---111111-1211----1111111---11111111111--------------111111111----1-------1-1--111111--1--1--1111111--111111-1--121111111111111111111111111111111111-1111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111-11111111111111111111111111111111111--1111------11111111111111111-111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111-11111111111111-1--------------------------11111------11 1122434-61224451111111111111111111111111111111-1111111-111111111111111111111111111111111-111111122211135431364C8A99BA6575494CE5F7fdF-F9G4647E65EC47843726E4947799656681323A11842443O22232A5881593333332 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 140 STR:RPRED 100.0 SQ:SECSTR cTEEEEEEEEcHHHHHTTcHHHHHHHHHHHTcEEEEEEEEcccHHHHHHHTGGGTTcTTHHHHHHHHTcccEEEEEEEEETHHHHHHHHHccccGGGccTTcHHHHHccccccccEEEcccHHHHHHHHHHHccGGGccc PSIPRED cccEEEEEEEccHHHHcccHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHcccccHHHHHHHHccccEEEEEEEcccHHHHHHHHHccccHHHcccccEEcccccccccEEEcccccHHHHHHHHHHHccHHHHcc //