[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : nudH
DDBJ      :nudH         dGTP pyrophosphohydrolase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.111.1
:208 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   105->206 2a96A PDBj 6e-12 23.0 %
:RPS:SCOP  136->195 1d2tA  a.111.1.1 * 1e-07 31.0 %
:HMM:SCOP  1->206 1d2tA_ a.111.1.1 * 2.6e-30 21.1 %
:RPS:PFM   134->199 PF01569 * PAP2 4e-07 36.4 %
:HMM:PFM   90->206 PF01569 * PAP2 1e-25 30.8 117/129  
:HMM:PFM   48->106 PF01005 * Flavi_NS2A 0.00063 12.1 58/216  
:BLT:SWISS 105->195 Y4367_DICDI 8e-06 35.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30302.1 GT:GENE nudH GT:PRODUCT dGTP pyrophosphohydrolase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(248297..248923) GB:FROM 248297 GB:TO 248923 GB:DIRECTION - GB:GENE nudH GB:PRODUCT dGTP pyrophosphohydrolase GB:PROTEIN_ID ACD30302.1 GB:DB_XREF GI:187712005 GB:GENE:GENE nudH LENGTH 208 SQ:AASEQ MNYFDHKLAKTTAIYGFLTLIIAILSYNFLDIKFATLVHSSELFGTGISTIAAFTSNIFSPKVWTVITAIATVICIYKHIVKKPSQKLYIMSLSLIMTIIITTIVKVILARYRPEMLLFDNHYGFHFFSFKKAYNSMPSGHTALTFAGLLAIANFFEKKYITLIAIIISGLVAVSRIIILDHFISDVIVAAYIGIFTYLWSKAFVESK GT:EXON 1|1-208:0| BL:SWS:NREP 1 BL:SWS:REP 105->195|Y4367_DICDI|8e-06|35.7|84/271| TM:NTM 4 TM:REGION 12->34| TM:REGION 60->81| TM:REGION 88->110| TM:REGION 169->191| SEG 65->74|tvitaiatvi| SEG 90->104|imslslimtiiitti| RP:PDB:NREP 1 RP:PDB:REP 105->206|2a96A|6e-12|23.0|100/217| RP:PFM:NREP 1 RP:PFM:REP 134->199|PF01569|4e-07|36.4|66/132|PAP2| HM:PFM:NREP 2 HM:PFM:REP 90->206|PF01569|1e-25|30.8|117/129|PAP2| HM:PFM:REP 48->106|PF01005|0.00063|12.1|58/216|Flavi_NS2A| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01569|IPR000326| GO:PFM GO:0016020|"GO:membrane"|PF01569|IPR000326| RP:SCP:NREP 1 RP:SCP:REP 136->195|1d2tA|1e-07|31.0|58/222|a.111.1.1| HM:SCP:REP 1->206|1d2tA_|2.6e-30|21.1|199/224|a.111.1.1|1/1|Acid phosphatase/Vanadium-dependent haloperoxidase| OP:NHOMO 33 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------1------------------------------------------1---1---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-111111------------------------------------------------------1-1---------------------------------------1----------------------------------------------------------------------------1--------------------1-----------------------11-----------------------------------------------------------------------------------------------------------------------------------------1111-------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 48.1 SQ:SECSTR ########################################################################################################HHHHHccccHHHHHTcccccGGGHHHHHTccccccHHHHHHHHHHHHHHHHcGGGHHHHHHHHH##HHHHHHHHHTcccHHHHHHHHHHHHHHHHHHTTcHH## PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcc //