[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : nuoA
DDBJ      :nuoA         NADH dehydrogenase I, A subunit
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  366/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
:132 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   32->131 PF00507 * Oxidored_q4 2e-14 36.2 %
:HMM:PFM   27->131 PF00507 * Oxidored_q4 1.1e-31 41.4 99/102  
:BLT:SWISS 36->132 NUOA_RALSO 9e-24 54.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30194.1 GT:GENE nuoA GT:PRODUCT NADH dehydrogenase I, A subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 102993..103391 GB:FROM 102993 GB:TO 103391 GB:DIRECTION + GB:GENE nuoA GB:PRODUCT NADH dehydrogenase I, A subunit GB:PROTEIN_ID ACD30194.1 GB:DB_XREF GI:187711897 GB:GENE:GENE nuoA LENGTH 132 SQ:AASEQ MSTSVYEQFAPILIFLIIAFGLGAAFAIIGKVLSVIVGANNPNKTKGETFECGFPTFGDAREKLDVRFYLIAVLFLVFDLELAFIIPWGINLRASAGMPAISDHAFFAMIIFLVVLFLGLIYAWKKGALEWE GT:EXON 1|1-132:0| BL:SWS:NREP 1 BL:SWS:REP 36->132|NUOA_RALSO|9e-24|54.9|91/119| TM:NTM 3 TM:REGION 14->36| TM:REGION 67->89| TM:REGION 103->124| SEG 12->30|ilifliiafglgaafaiig| SEG 110->121|iiflvvlflgli| RP:PFM:NREP 1 RP:PFM:REP 32->131|PF00507|2e-14|36.2|94/108|Oxidored_q4| HM:PFM:NREP 1 HM:PFM:REP 27->131|PF00507|1.1e-31|41.4|99/102|Oxidored_q4| GO:PFM:NREP 2 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF00507|IPR000440| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00507|IPR000440| OP:NHOMO 390 OP:NHOMOORG 378 OP:PATTERN ----------------------------1--1-----------------1------------------ 222-1----------11-------11-----11---1--------1--1------------------1111-----------1-----11111------1-11---1111---------------111111111211221-11111-11---111--1--1-1-1--------11-----1-----------1-111111111111111------1-1111-----------1----------------------------------------------------------------------------------------------1-----------------------1--1---11----11-------1--111111111111111111111111111111111-111111111111111122211111111111111111111--------111-1111111111111-111111111111111111111111-11111111111111111111111111111111111111111111111111111111211111111112111---------------11111111-111111-11--11-------1--------1-11111-1---------------------1--------2111--------------------------------------------------------------------------------------------1111111111------------------------------1-11111-1111111-1111111111111--------------11111111111111111-111111------------------------------------------------1 -------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------111------1---1-1---1--1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 132-133| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccHHcccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccc //