[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : nuoB
DDBJ      :nuoB         NADH dehydrogenase I, B subunit
Swiss-Prot:NUOB_FRATW   RecName: Full=NADH-quinone oxidoreductase subunit B;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit B;AltName: Full=NDH-1 subunit B;

Homologs  Archaea  67/68 : Bacteria  604/915 : Eukaryota  142/199 : Viruses  0/175   --->[See Alignment]
e.19.1
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->149 3i9v6 PDBj 3e-25 46.9 %
:RPS:PDB   23->151 1e3dA PDBj 6e-25 16.3 %
:RPS:SCOP  6->158 2fug61  e.19.1.2 * 4e-41 50.0 %
:HMM:SCOP  6->153 2fug61 e.19.1.2 * 3.8e-62 54.4 %
:RPS:PFM   64->145 PF01058 * Oxidored_q6 2e-17 48.8 %
:HMM:PFM   36->144 PF01058 * Oxidored_q6 1.7e-26 32.1 109/131  
:BLT:SWISS 1->158 NUOB_FRATW 3e-82 100.0 %
:PROS 117->133|PS01150|COMPLEX1_20K
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30195.1 GT:GENE nuoB GT:PRODUCT NADH dehydrogenase I, B subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 103382..103858 GB:FROM 103382 GB:TO 103858 GB:DIRECTION + GB:GENE nuoB GB:PRODUCT NADH dehydrogenase I, B subunit GB:PROTEIN_ID ACD30195.1 GB:DB_XREF GI:187711898 GB:GENE:GENE nuoB LENGTH 158 SQ:AASEQ MGIGNENKGFITASADALINWVRTGSLWPVTTGLACCAVEMMHAGAARYDLDRFGIVFRPSPRQSDVLIVAGTLCNKMAPALRQVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALVYGIIQLQNKIIRKDTIARK GT:EXON 1|1-158:0| SW:ID NUOB_FRATW SW:DE RecName: Full=NADH-quinone oxidoreductase subunit B; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit B;AltName: Full=NDH-1 subunit B; SW:GN Name=nuoB; OrderedLocusNames=FTW_0107; SW:KW 4Fe-4S; Cell inner membrane; Cell membrane; Complete proteome; Iron;Iron-sulfur; Membrane; Metal-binding; NAD; Oxidoreductase; Quinone;Transport; Ubiquinone. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->158|NUOB_FRATW|3e-82|100.0|158/158| GO:SWS:NREP 10 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 117->133|PS01150|COMPLEX1_20K|PDOC00858| SEG 104->117|gggyyhysysvvrg| BL:PDB:NREP 1 BL:PDB:REP 6->149|3i9v6|3e-25|46.9|128/145| RP:PDB:NREP 1 RP:PDB:REP 23->151|1e3dA|6e-25|16.3|129/262| RP:PFM:NREP 1 RP:PFM:REP 64->145|PF01058|2e-17|48.8|82/128|Oxidored_q6| HM:PFM:NREP 1 HM:PFM:REP 36->144|PF01058|1.7e-26|32.1|109/131|Oxidored_q6| GO:PFM:NREP 4 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF01058|IPR006137| GO:PFM GO:0048038|"GO:quinone binding"|PF01058|IPR006137| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF01058|IPR006137| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01058|IPR006137| RP:SCP:NREP 1 RP:SCP:REP 6->158|2fug61|4e-41|50.0|136/144|e.19.1.2| HM:SCP:REP 6->153|2fug61|3.8e-62|54.4|147/0|e.19.1.2|1/1|HydA/Nqo6-like| OP:NHOMO 1241 OP:NHOMOORG 813 OP:PATTERN 11313121222222213112222121111211212223222222132411233132232231121-11 22212---------12122-21--11122221111-11111111-1--1-----------22212112221--------21111111211111---1--1-11--22211--------------1111111111212222233321211211111111111111212111111111111111111111--1-1-111111111111111------111111----------11------------------------------------------------------------------------------------------1---1----------2-------1-1--2--112221----22--211--23-111111111212111112533311111111111-11111111111111113222212222111111222211122222222533-12231111111111111111111111111111111111-111111111111222211123233221131122111111111111231111111112111111111122211-1-2-1-442223-433232418333313-2122211111111111111111242333221---------------------1----11--211111111122222213332322233-3333322333323333333222211122222222222222222232222331-21111111111111111111111112--1-----1----------11111111111-1111111111111-1111111111111--------------11111111111111112-111111------------------------------------121111-11-251 ----111-211-1111121112222312212122221222122211-111223211222111111----1--111------11111---12111111111111112-1-32211111-------22-2-4J1-321----3--2------1--1-11-111-1111232121121111-----1124-41131134231 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 99.4 SQ:SECSTR HHHHTccTTcHHHHHHHHHHHHccEEEEEEcccccHHHHHHHTccTTcHHHHHHTTcEHHTcccccEEEEEccEEcTGGEHHHHHHHHGGGccEEEEEcHHHHcTTcTTcEEcHHHHHGGGTcccEEEccccccHHHHHHHHHHHHTTcccTTTccc# DISOP:02AL 158-159| PSIPRED cccccccccEEEEEHHHHHHHHHHccccEEcccccHHHHHHHHHccccccHHHHcEEEcccHHHccEEEEEcccccccHHHHHHHHHHcccccEEEEEccccccccccccccHHHcccHHcEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccc //