[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : nuoC
DDBJ      :nuoC         NADH dehydrogenase I, C subunit
Swiss-Prot:NUOC_FRATM   RecName: Full=NADH-quinone oxidoreductase subunit C;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit C;AltName: Full=NDH-1 subunit C;

Homologs  Archaea  13/68 : Bacteria  572/915 : Eukaryota  150/199 : Viruses  0/175   --->[See Alignment]
d.307.1
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   53->179 3i9v5 PDBj 1e-18 48.5 %
:RPS:PDB   26->213 2c6zA PDBj 2e-21 5.6 %
:RPS:SCOP  12->194 2fug51  d.307.1.1 * 2e-34 32.0 %
:HMM:SCOP  6->206 2fug51 d.307.1.1 * 5.3e-49 47.9 %
:RPS:PFM   53->176 PF00329 * Complex1_30kDa 1e-22 59.3 %
:HMM:PFM   97->176 PF00329 * Complex1_30kDa 8.3e-31 50.6 79/103  
:BLT:SWISS 1->214 NUOC_FRATM e-125 100.0 %
:PROS 143->164|PS00542|COMPLEX1_30K

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30196.1 GT:GENE nuoC GT:PRODUCT NADH dehydrogenase I, C subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 103861..104505 GB:FROM 103861 GB:TO 104505 GB:DIRECTION + GB:GENE nuoC GB:PRODUCT NADH dehydrogenase I, C subunit GB:PROTEIN_ID ACD30196.1 GB:DB_XREF GI:187711899 GB:GENE:GENE nuoC LENGTH 214 SQ:AASEQ MSTKLQDHFDKITKILSGFGVEGCISYGEITFSIRDQRDIHLILKKLKKEYLFEQLTDVTAVDYLTYGQSDWQVGKVVSQTGFSRGRQQDFKTAAVDNRFEIIYQLLSMANNVRIRVKCKLKDAQIILVDSVSDLWPSANWAEREVYDMFGIYFNNHPDLRRVLTDYGFVGHPLRKDFPQTGYVEMRYDENLGRVVYEPVEIDDRVNTPRVIRN GT:EXON 1|1-214:0| SW:ID NUOC_FRATM SW:DE RecName: Full=NADH-quinone oxidoreductase subunit C; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit C;AltName: Full=NDH-1 subunit C; SW:GN Name=nuoC; OrderedLocusNames=FTM_0096; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane; NAD;Oxidoreductase; Quinone; Transport; Ubiquinone. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->214|NUOC_FRATM|e-125|100.0|214/214| GO:SWS:NREP 7 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 143->164|PS00542|COMPLEX1_30K|PDOC00468| BL:PDB:NREP 1 BL:PDB:REP 53->179|3i9v5|1e-18|48.5|99/196| RP:PDB:NREP 1 RP:PDB:REP 26->213|2c6zA|2e-21|5.6|179/273| RP:PFM:NREP 1 RP:PFM:REP 53->176|PF00329|1e-22|59.3|91/103|Complex1_30kDa| HM:PFM:NREP 1 HM:PFM:REP 97->176|PF00329|8.3e-31|50.6|79/103|Complex1_30kDa| GO:PFM:NREP 2 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF00329|IPR001268| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00329|IPR001268| RP:SCP:NREP 1 RP:SCP:REP 12->194|2fug51|2e-34|32.0|150/191|d.307.1.1| HM:SCP:REP 6->206|2fug51|5.3e-49|47.9|169/0|d.307.1.1|1/1|Nqo5-like| OP:NHOMO 816 OP:NHOMOORG 735 OP:PATTERN ------------------------2---121------------------111----111--111---- 22212---------11111-11--11111111111111111111-1--------------11111111111-----------1222221111----1--1-11--22211--------------11111111112122222111211111111111111111111121111111111-1111-11111----1-111111111111111------111111----------1-----------------------------------------------------------------------------------------------1-----------------------2--1-1111----11-------22-111111111111111112222211111111111-11111111111111112221212211111111111111111111111222-11111121112211111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111121111-------11-----222122213222211-11-1111111111111111111111211111---------------------1----11--211111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111111111111111--1----------------11111111111-1111111111111-1111111111111--------------11111111111111111-111111-------------------------------------1--------121 ------1-----21111111111111111111111111111111111111111111111111111----1--111------11111---12111111111111111-12-2321111111111-11121151-2211111111111111111-1112111221211211--2221111--------1121-1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 185 STR:RPRED 86.4 SQ:SECSTR #########################THHHHcccccccccccHHHHHHHHHHHHHHHHTTTccEEEEEcccTTcTTTcGGGGEEEETTEEEEcccccGGGTTHHHHHHHHHHHTTcEEEEcccTTcccc#cTccccGGGEEEcccEEEEEEcccHHHHHHHHHHcTTcEEEEEEccccccGGGc##EEEEETTEEEEEccHHHHHHHHHHHHHc# DISOP:02AL 214-215| PSIPRED ccHHHHHHHHHHHHHccccEEEEEEEcccEEEEEEcHHHHHHHHHHccccccccEEEEEEEEEEEEccccccHHHHHHHHcccccHHccccccccccccEEEEEEEEEccccEEEEEEEEEcccccccccccccccccccHHHHHHHHHccEEEcccccccccccccccccccccccccccccEEEEccccccEEEEccccccccccccEEccc //