[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : nuoH
DDBJ      :nuoH         NADH dehydrogenase I, H subunit
Swiss-Prot:NUOH_FRATM   RecName: Full=NADH-quinone oxidoreductase subunit H;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit H;AltName: Full=NDH-1 subunit H;

Homologs  Archaea  50/68 : Bacteria  589/915 : Eukaryota  46/199 : Viruses  0/175   --->[See Alignment]
b.71.1
:336 amino acids
:PSIPRED
:RPS:SCOP  149->237 1bf2A2  b.71.1.1 * 7e-11 13.8 %
:RPS:PFM   27->323 PF00146 * NADHdh 3e-74 54.4 %
:HMM:PFM   9->327 PF00146 * NADHdh 1.1e-122 48.5 307/311  
:BLT:SWISS 1->336 NUOH_FRATM e-174 100.0 %
:PROS 50->65|PS00667|COMPLEX1_ND1_1
:PROS 208->221|PS00668|COMPLEX1_ND1_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30201.1 GT:GENE nuoH GT:PRODUCT NADH dehydrogenase I, H subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 109945..110955 GB:FROM 109945 GB:TO 110955 GB:DIRECTION + GB:GENE nuoH GB:PRODUCT NADH dehydrogenase I, H subunit GB:PROTEIN_ID ACD30201.1 GB:DB_XREF GI:187711904 GB:GENE:GENE nuoH LENGTH 336 SQ:AASEQ MLGYILWTSLYVLLIVIPLILVVAYYTYAERKVIGYMQDRIGPNRVGSFGLLQPIFDALKLFLKEIIVPTNSNRYLFFIAPILAFAPAYAAWAVIPFSKGVVLSDMNLGLLYILAMTSFSIYGIVIAGWASNSKYSLFGALRAGAQVISYELAMGFAIVGVVIAAGSMGITGIIEAQSGGIWHWYFISLFPLFIVYFIAGIAETNRAPFDVVEGESEIVAGHHIEYTGSRFALFFLAEYANMILISILTSIMFLGGWNSPFQATALESIFGFVPGVVWLFAKTGIFMFMFLWVRATYPRYRYDQIMRLGWKIFIPLTFVWVVIVACMVRLGVGPWW GT:EXON 1|1-336:0| SW:ID NUOH_FRATM SW:DE RecName: Full=NADH-quinone oxidoreductase subunit H; EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit H;AltName: Full=NDH-1 subunit H; SW:GN Name=nuoH; OrderedLocusNames=FTM_0101; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane; NAD;Oxidoreductase; Quinone; Transmembrane; Ubiquinone. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->336|NUOH_FRATM|e-174|100.0|336/336| GO:SWS:NREP 7 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0048038|"GO:quinone binding"|Quinone| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 50->65|PS00667|COMPLEX1_ND1_1|PDOC00570| PROS 208->221|PS00668|COMPLEX1_ND1_2|PDOC00570| TM:NTM 8 TM:REGION 4->26| TM:REGION 78->100| TM:REGION 109->130| TM:REGION 145->167| TM:REGION 182->204| TM:REGION 232->254| TM:REGION 269->291| TM:REGION 309->331| SEG 10->26|lyvlliviplilvvayy| SEG 75->91|ylffiapilafapayaa| RP:PFM:NREP 1 RP:PFM:REP 27->323|PF00146|3e-74|54.4|285/306|NADHdh| HM:PFM:NREP 1 HM:PFM:REP 9->327|PF00146|1.1e-122|48.5|307/311|NADHdh| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF00146|IPR001694| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00146|IPR001694| RP:SCP:NREP 1 RP:SCP:REP 149->237|1bf2A2|7e-11|13.8|87/113|b.71.1.1| OP:NHOMO 792 OP:NHOMOORG 685 OP:PATTERN 11111111111111111111222111111211----------------11112-22222231111-11 22212---------11111-11--11111111112111111111-1--1-----------22111112221---------1-13211111111---1--1-11--22211--------------1111111111212222212121111111111111111111111111111111111111111111--1-1-111111111111111------111111----------11----------------------------------------------------------------------------------------------1----------1-------1-1--2--1-1111----11-------22-111111111111111112322211111111111-11111121111111112221112211111111222211111111111222-11131111112111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111121111---1---231112-222122217222212-2111111111111111111111121211111---------------------1----11--311111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111111111111111--1----------------11111111111-1111111111111-1111111111111--------------11111111111111111-111111---------------------------------------1----1-121 ---------------------------1---11-11-------1---1------241-----1-1----------------------------1---11----1-1------11111-----1-1--1-12--11-----1--21--------1-1------22--12--1-11-1----------1-8-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //