[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : nuoJ
DDBJ      :nuoJ         NADH dehydrogenase I, J subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:201 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->161 PF00499 * Oxidored_q3 1.2e-22 23.6 144/144  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30203.1 GT:GENE nuoJ GT:PRODUCT NADH dehydrogenase I, J subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 111462..112067 GB:FROM 111462 GB:TO 112067 GB:DIRECTION + GB:GENE nuoJ GB:PRODUCT NADH dehydrogenase I, J subunit GB:PROTEIN_ID ACD30203.1 GB:DB_XREF GI:187711906 GB:GENE:GENE nuoJ LENGTH 201 SQ:AASEQ MVVTDILFYTFASLAIIFALVLVLANNPVNSVIAMIFTFIFTAAVWIILQQVYLALLLIVVYVGAVLVMFLFVVFMLDLHVEEQGRVGRFFYALAAVVVCAIFATVISYAATNVFAGAMMQGGVGGLKIIGLTMFSNANLYVFELVDFILLAAMTAAITLTLRAKRKGNKTVDPAQQVKVRAKDRLTMVKMPSNNEGAKDE GT:EXON 1|1-201:0| TM:NTM 4 TM:REGION 3->25| TM:REGION 45->67| TM:REGION 93->115| TM:REGION 141->162| SEG 11->25|faslaiifalvlvla| SEG 48->77|ilqqvylalllivvyvgavlvmflfvvfml| SEG 149->162|illaamtaaitltl| HM:PFM:NREP 1 HM:PFM:REP 16->161|PF00499|1.2e-22|23.6|144/144|Oxidored_q3| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 201-202| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHcccccHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHccccEEEEEEccHHHcccccc //