[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : nuoK
DDBJ      :nuoK         NADH dehydrogenase I, K subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:HMM:PFM   12->105 PF00420 * Oxidored_q2 7.8e-26 38.7 93/95  
:BLT:SWISS 6->105 NUOK_RICTY 3e-09 31.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30204.1 GT:GENE nuoK GT:PRODUCT NADH dehydrogenase I, K subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 112060..112377 GB:FROM 112060 GB:TO 112377 GB:DIRECTION + GB:GENE nuoK GB:PRODUCT NADH dehydrogenase I, K subunit GB:PROTEIN_ID ACD30204.1 GB:DB_XREF GI:187711907 GB:GENE:GENE nuoK LENGTH 105 SQ:AASEQ MNSISVSVTHGLIFSTLLFVISVAGIIINRRNILILLMSIELMLLAVNTNFLIFANMHQQAMGGVFVFFIMAVAAAETAIGLAIVVAIFRKRKTIDLSKLNTLRG GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 6->105|NUOK_RICTY|3e-09|31.0|100/110| TM:NTM 3 TM:REGION 5->27| TM:REGION 34->56| TM:REGION 65->87| SEG 26->45|iiinrrnilillmsielmll| SEG 65->76|vfvffimavaaa| HM:PFM:NREP 1 HM:PFM:REP 12->105|PF00420|7.8e-26|38.7|93/95|Oxidored_q2| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcc //