[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : nusG
DDBJ      :nusG         transcription termination/antitermination factor NusG
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  895/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.34.5d.58.42
:177 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->106 2k06A PDBj 3e-29 51.0 %
:BLT:PDB   118->175 2jvvA PDBj 3e-19 69.0 %
:RPS:PDB   52->175 2ckkA PDBj 1e-18 14.0 %
:RPS:SCOP  3->109 1nz8A  d.58.42.1 * 1e-27 41.1 %
:RPS:SCOP  122->175 1m1gA2  b.34.5.4 * 2e-16 61.1 %
:HMM:SCOP  1->112 1nz8A_ d.58.42.1 * 1.4e-30 45.5 %
:HMM:SCOP  119->176 1m1gA2 b.34.5.4 * 1.6e-19 58.6 %
:RPS:PFM   3->97 PF02357 * NusG 1e-18 55.2 %
:HMM:PFM   2->98 PF02357 * NusG 3.5e-26 47.7 86/92  
:HMM:PFM   125->155 PF00467 * KOW 3.5e-10 40.7 27/32  
:BLT:SWISS 3->175 NUSG_VIBVU 3e-55 59.6 %
:PROS 159->168|PS01014|NUSG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30284.1 GT:GENE nusG GT:PRODUCT transcription termination/antitermination factor NusG GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 224522..225055 GB:FROM 224522 GB:TO 225055 GB:DIRECTION + GB:GENE nusG GB:PRODUCT transcription termination/antitermination factor NusG GB:PROTEIN_ID ACD30284.1 GB:DB_XREF GI:187711987 GB:GENE:GENE nusG LENGTH 177 SQ:AASEQ MLWYVVQVHSGYEKRVKAQLEENIEIAGLKNNFGRILVPTENVVEMKGGQKRKSERKYFPGYVLIEADLSTDAWNLVKSVPRVLTVVGSKGKPIPLSKAEVDRILDFVEGSKSTVEPRLRKSYHVGEVVRVLEGPFNDFTGVIEEVNYEKSRLRVAVSIFGRSTPVELEFSQVEKES GT:EXON 1|1-177:0| BL:SWS:NREP 1 BL:SWS:REP 3->175|NUSG_VIBVU|3e-55|59.6|171/182| PROS 159->168|PS01014|NUSG|PDOC00775| BL:PDB:NREP 2 BL:PDB:REP 3->106|2k06A|3e-29|51.0|104/123| BL:PDB:REP 118->175|2jvvA|3e-19|69.0|58/59| RP:PDB:NREP 1 RP:PDB:REP 52->175|2ckkA|1e-18|14.0|114/120| RP:PFM:NREP 1 RP:PFM:REP 3->97|PF02357|1e-18|55.2|87/92|NusG| HM:PFM:NREP 2 HM:PFM:REP 2->98|PF02357|3.5e-26|47.7|86/92|NusG| HM:PFM:REP 125->155|PF00467|3.5e-10|40.7|27/32|KOW| GO:PFM:NREP 2 GO:PFM GO:0003711|"GO:transcription elongation regulator activity"|PF02357|IPR006645| GO:PFM GO:0032968|"GO:positive regulation of RNA elongation from RNA polymerase II promoter"|PF02357|IPR006645| RP:SCP:NREP 2 RP:SCP:REP 3->109|1nz8A|1e-27|41.1|107/119|d.58.42.1| RP:SCP:REP 122->175|1m1gA2|2e-16|61.1|54/58|b.34.5.4| HM:SCP:REP 1->112|1nz8A_|1.4e-30|45.5|112/0|d.58.42.1|1/1|N-utilization substance G protein NusG, N-terminal domain| HM:SCP:REP 119->176|1m1gA2|1.6e-19|58.6|58/58|b.34.5.4|1/1|Translation proteins SH3-like domain| OP:NHOMO 921 OP:NHOMOORG 899 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111142111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111211111112221111111111111111111111111111111111111111-111115111211111111111111111111111221111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-1--11111-------1111111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1-----2---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 174 STR:RPRED 98.3 SQ:SECSTR ##EEEEEEcTTcHHHHHHHHHHHHHHHTcTTTccccccccccccccccccccccccccccTTcEEEEcccTTcGGGTTcEEEEEEEETTEEEEEETTTccEEEEEHccGGGEEEccccccccccTTcEEEEcccTTTTcEEEEEEEEGGGTEEEEEcccTTTTcEEEEEGGGEEEc# DISOP:02AL 176-178| PSIPRED cEEEEEEEEcccHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEEEccEEEEEEEEccccEEEEEEEEcHHHHHHHHcccccEEEEccccccEEccHHHHHHHHHHHHHHccccccccccccccccEEEEEEccccccEEEEEEEcccccEEEEEEEEcccEEEEEEcHHHcEEcc //