[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ompH
DDBJ      :ompH         outer membrane protein OmpH
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  47/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.48.1
:167 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   20->160 1sg2C PDBj 6e-10 26.8 %
:RPS:SCOP  22->162 1sg2A  f.48.1.1 * 2e-13 23.9 %
:HMM:SCOP  19->163 1u2mA_ f.48.1.1 * 8.5e-26 28.1 %
:RPS:PFM   11->160 PF03938 * OmpH 9e-07 24.0 %
:HMM:PFM   8->163 PF03938 * OmpH 8.4e-27 23.9 155/158  
:BLT:SWISS 6->162 SKP_BLOFL 3e-16 29.3 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30379.1 GT:GENE ompH GT:PRODUCT outer membrane protein OmpH GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 365473..365976 GB:FROM 365473 GB:TO 365976 GB:DIRECTION + GB:GENE ompH GB:PRODUCT outer membrane protein OmpH GB:PROTEIN_ID ACD30379.1 GB:DB_XREF GI:187712082 GB:GENE:GENE ompH LENGTH 167 SQ:AASEQ MKKIALSICVLVSAFTAAYADTKIAVVNPVEIFNDSDLGSVSVKKLENDLKPDATKLKQEQDNIMQQMKTLQDNSATMTKSELDKKQQQIQQEQQNFAEKARILQQKEYTAKDKLSKKFQASFDKAVQTIAKQKNYNVVLTTQALAYVNNVDDISSQVVELMNKDSE GT:EXON 1|1-167:0| BL:SWS:NREP 1 BL:SWS:REP 6->162|SKP_BLOFL|3e-16|29.3|157/168| COIL:NAA 33 COIL:NSEG 1 COIL:REGION 75->107| SEG 87->95|qqqiqqeqq| BL:PDB:NREP 1 BL:PDB:REP 20->160|1sg2C|6e-10|26.8|138/142| RP:PFM:NREP 1 RP:PFM:REP 11->160|PF03938|9e-07|24.0|150/158|OmpH| HM:PFM:NREP 1 HM:PFM:REP 8->163|PF03938|8.4e-27|23.9|155/158|OmpH| GO:PFM:NREP 1 GO:PFM GO:0005515|"GO:protein binding"|PF03938|IPR005632| RP:SCP:NREP 1 RP:SCP:REP 22->162|1sg2A|2e-13|23.9|138/141|f.48.1.1| HM:SCP:REP 19->163|1u2mA_|8.5e-26|28.1|139/143|f.48.1.1|1/1|OmpH-like| OP:NHOMO 47 OP:NHOMOORG 47 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------1--------------1------1-------------111111---------------------------------1111-----------------1-------1111111111111111------------1------------------------------1111---------1---111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 82.6 SQ:SECSTR ###################ccccEEEEcHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHH###HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccEEEEGGGccccTTccccHHHHHH####### PSIPRED cHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHccccccHHHHHHHHccccc //