[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : oxyR
DDBJ      :oxyR         oxidative stress transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  746/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:289 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   95->285 1i6aA PDBj 2e-29 35.1 %
:RPS:PDB   1->210 1b9nB PDBj 5e-26 10.4 %
:RPS:SCOP  1->104 1b9mA1  a.4.5.8 * 1e-18 9.6 %
:RPS:SCOP  92->285 1i69A  c.94.1.1 * 1e-42 34.9 %
:HMM:SCOP  1->112 1b9mA1 a.4.5.8 * 4.5e-18 31.4 %
:HMM:SCOP  87->289 2esnA2 c.94.1.1 * 9.5e-28 21.3 %
:RPS:PFM   4->61 PF00126 * HTH_1 3e-09 41.4 %
:RPS:PFM   92->241 PF03466 * LysR_substrate 1e-11 25.0 %
:HMM:PFM   93->272 PF03466 * LysR_substrate 4e-37 25.6 180/209  
:HMM:PFM   4->61 PF00126 * HTH_1 7.3e-17 43.1 58/60  
:BLT:SWISS 1->287 OXYR_HAEIN 2e-51 38.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31022.1 GT:GENE oxyR GT:PRODUCT oxidative stress transcriptional regulator GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1212071..1212940 GB:FROM 1212071 GB:TO 1212940 GB:DIRECTION + GB:GENE oxyR GB:PRODUCT oxidative stress transcriptional regulator GB:PROTEIN_ID ACD31022.1 GB:DB_XREF GI:187712725 GB:GENE:GENE oxyR LENGTH 289 SQ:AASEQ MNTRTLEYIISVYETKSFITASEKCFVSQPALSMQIKKFEEYIGIQIFERGTKQVLITKSGMKIVNQAYKILDEVNNLKKIAELLLENGKISITIGAFPTLCPYLMPKILPAIKQELPNLSIAVIEEKTDILVKMLDQGKIDFALLATPTENYQFHRKKVFDDKFYVAVAKTNPLAKNKQICIREIVKQNLMLLDEGHCLRDQTLKLCALKEFNNNDFKGSSLETLRQMVSIDEGITLVPKIACTKADNVKYIDIDNRDFYREIDLVMRKSSIYEDLFAKIAKIISNNH GT:EXON 1|1-289:0| BL:SWS:NREP 1 BL:SWS:REP 1->287|OXYR_HAEIN|2e-51|38.6|285/301| BL:PDB:NREP 1 BL:PDB:REP 95->285|1i6aA|2e-29|35.1|191/212| RP:PDB:NREP 1 RP:PDB:REP 1->210|1b9nB|5e-26|10.4|202/245| RP:PFM:NREP 2 RP:PFM:REP 4->61|PF00126|3e-09|41.4|58/60|HTH_1| RP:PFM:REP 92->241|PF03466|1e-11|25.0|148/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 93->272|PF03466|4e-37|25.6|180/209|LysR_substrate| HM:PFM:REP 4->61|PF00126|7.3e-17|43.1|58/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 1->104|1b9mA1|1e-18|9.6|104/122|a.4.5.8| RP:SCP:REP 92->285|1i69A|1e-42|34.9|189/206|c.94.1.1| HM:SCP:REP 1->112|1b9mA1|4.5e-18|31.4|105/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 87->289|2esnA2|9.5e-28|21.3|202/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 4848 OP:NHOMOORG 758 OP:PATTERN -----------------------1-----------111----1------------------------- 555-611344421164411-13112E11111244544BFB-546---11---5331-3--213123B3472111111111255111112221-211---117112612-5---------------1---1----1-44423---31533633523221111113438856211111111111112-11---43DCCCCCCDC4BBCCDB85B9CGCBD2428342688777Lb1223433333332335464734444443424DD444555643552424423331431111111111123332222344332112221114-54CD5554565344367741128311153621HK552212522121-242124111-----13C7D3365734466776575569-12722K38C95-LCCB69CHJCDBBC33162B345737B5455555524452334------------------------------287127ZMJRPPOSTRCDDDDKKXaEDEEAEWKZLSPW25IGA55675L9I3KAAA752217222333233244566231223-115221-21133522-332335-24-2-----------------1312266A76433A495478777467B88899A98A81-12336------D7E65BCEEEBEB9CED-EDDEFABEDCECEDDDED9JNG9945AC7C9CBEEECB9E99BH8A8999B3-844556445665--151111134333568O222334233232443FGFGIAH456H3IHHJJMJO8OOPK5CEL32212222255779888889A87767AABAA67622221-3222------------1-------------------------------------241 -------------2------------------------------------------------------------------------------------------------------------------------------------------------5------1----5----1------------7-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 289 STR:RPRED 100.0 SQ:SECSTR EcHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTccccccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHcTTccccccHHHHHHTTccHTccccccEEEEEEEcccEEEEEETTcccEEEEEccHHHHHHHTccTTcEEcGGGcEEEccHHHHTTccEEEEEEEEEEEEcccEEEEEEEcTTccEEEEEEEGGGcTHTccEEEEEEccHHHHHHHHHHTccEEEEEGGGccTcTTcEEEEccTTcccEEEEEEEETTcTTHHHHHHHHHHHHHTT DISOP:02AL 288-290| PSIPRED ccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccEEEEccccccccEEEEEEEEccEEEEEcccccccccccccHHHHccccEEEcccccHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHccccEEEEEHHHccccccEEEEEccccccEEEEEEEEcccccccHHHHHHHHHHHHcc //