[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : pabA
DDBJ      :pabA         para-aminobenzoate synthase component
Swiss-Prot:             

Homologs  Archaea  62/68 : Bacteria  819/915 : Eukaryota  135/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:184 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->183 1qdlB PDBj 3e-33 42.5 %
:RPS:PDB   2->184 2a9vB PDBj 3e-32 23.8 %
:RPS:SCOP  14->184 1a9xB2  c.23.16.1 * 5e-31 23.2 %
:HMM:SCOP  1->185 1qdlB_ c.23.16.1 * 1.8e-48 35.7 %
:RPS:PFM   5->184 PF00117 * GATase 2e-27 36.9 %
:HMM:PFM   4->182 PF00117 * GATase 8.5e-48 34.6 179/192  
:BLT:SWISS 1->183 TRPG_SULSO 5e-33 43.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31525.1 GT:GENE pabA GT:PRODUCT para-aminobenzoate synthase component GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1085715..1086269) GB:FROM 1085715 GB:TO 1086269 GB:DIRECTION - GB:GENE pabA GB:PRODUCT para-aminobenzoate synthase component GB:PROTEIN_ID ACD31525.1 GB:DB_XREF GI:187713228 GB:GENE:GENE pabA LENGTH 184 SQ:AASEQ MVLYIDHYDSFSSTIVDYIIYLGYQVSMLKTDEQIDNIDQYSHIIIGPGPGHPDELKNIYPIIEYCQQKKLPLLGICLGHQLIAQYYGAKIIKAKQIYHGKFSEIKQLQSSALYKDHPVKFAVIRYHSLIVNDIKEPLITLAATDNHEIMAFAHQNAKIFGVQYHPEAYLTKYGLATLKNFLSI GT:EXON 1|1-184:0| BL:SWS:NREP 1 BL:SWS:REP 1->183|TRPG_SULSO|5e-33|43.1|181/195| BL:PDB:NREP 1 BL:PDB:REP 1->183|1qdlB|3e-33|42.5|181/195| RP:PDB:NREP 1 RP:PDB:REP 2->184|2a9vB|3e-32|23.8|181/195| RP:PFM:NREP 1 RP:PFM:REP 5->184|PF00117|2e-27|36.9|179/185|GATase| HM:PFM:NREP 1 HM:PFM:REP 4->182|PF00117|8.5e-48|34.6|179/192|GATase| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| RP:SCP:NREP 1 RP:SCP:REP 14->184|1a9xB2|5e-31|23.2|164/228|c.23.16.1| HM:SCP:REP 1->185|1qdlB_|1.8e-48|35.7|182/195|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 1928 OP:NHOMOORG 1016 OP:PATTERN 22-3--3222222222-22311233112422233333322222112112222222211211222--13 1111222222211111112-1111111111111111223221112111112211111122111111223132111222----12322222222111-112-121211121--------------111222211322211112221111411122211221112212234312211222121122223332-2233333333333333332433423333323555444444422444344444444444444411-1113-1112211112112212224442112322222222222222222222222222211222111134-131112221-1-12222112212121121222231211212113-211221111----1222112221121111111111111-22222222112-11111111111111121111222211111111111111-2112---1----11---------------121221211211111111111211111111111111111111111111111111111221111111111111111111111-3222212113221-111111111111122122323243444233333333322212112222113222233333423333333333231-11111-1-11322332232222222222-22222222222222222223332234323212222222232224222222231332333323333332311-1122221113222212212222212211111212221122421113111111111322333332144423333333333111111111122111222332212111-1-------------------------------1121112111214 11----1-311-1222221122222222212222222222222111222233441222222222222212222322212222222222-23222222222311223-121-------------------------------------------1-----1341--1-----332-2332Q3321332341732344332 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 100.0 SQ:SECSTR cEEEEEccccTTcHHHHHHHHTTccccEEETTccGGGGTTccEEEEcccccGGGTGGGHHHHHHHHHHccccEEEETHHHHHHHHHTTcEEEEEEEEEEEEEEEEEcccGcGGGTTcccEEEEEEEEEEEEEcccTTEEEEEEcccccccEEEEccccEEEEcccTTcTTcTTHHHHHHHHHHH PSIPRED cEEEEEccccHHHHHHHHHHHcccEEEEEEccccHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHccEEEEccccccccEEEEEEccccHHHccccccEEEEEEEEEEEEEcccccEEEEEcccccEEEEEEccccEEEEEccccccccccHHHHHHHHHcc //