[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : parB
DDBJ      :parB         chromosome partition protein B
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  716/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.4.14d.268.1
:304 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   49->177 1vz0H PDBj 2e-20 42.7 %
:RPS:PDB   39->138 3cyiA PDBj 1e-17 23.2 %
:RPS:SCOP  45->230 1vk1A  d.268.1.2 * 1e-25 15.8 %
:HMM:SCOP  44->180 1vk1A_ d.268.1.2 * 1e-26 34.3 %
:HMM:SCOP  129->244 1r71A_ a.4.14.1 * 4.5e-17 28.1 %
:RPS:PFM   49->130 PF02195 * ParBc 2e-10 40.7 %
:RPS:PFM   162->226 PF08535 * KorB 8e-05 30.8 %
:HMM:PFM   158->250 PF08535 * KorB 2.8e-29 38.9 90/93  
:HMM:PFM   48->136 PF02195 * ParBc 7.2e-23 42.5 87/90  
:BLT:SWISS 19->226 PARB_VIBCH 6e-26 34.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30514.1 GT:GENE parB GT:PRODUCT chromosome partition protein B GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 541670..542584 GB:FROM 541670 GB:TO 542584 GB:DIRECTION + GB:GENE parB GB:PRODUCT chromosome partition protein B GB:PROTEIN_ID ACD30514.1 GB:DB_XREF GI:187712217 GB:GENE:GENE parB LENGTH 304 SQ:AASEQ MAKKVSLMNRKINHKIHDTVAQEKKDILRAMQLQELNEQASKVGQLFELPLTIIKPNANQPRKTFKNIDSLADSIKENGVIQPIIVTAKKANGIHYIIAGERRYLASKQAGLTTIPCIVRQEESDANIVLLQLLENDQRENVSPFEEADALRDLIENKDVKKSDIAKILGRDNSWISMRLKIADANADIRELSNRGIIDDVRTLYELKKFAEEIPQGAQEFVKKALENKISGSYRSAITRYRDNWKRKAEILDSTKIDVITIKDIAKDGNLLKIKGSRCGTKNYTYTFEITPEFKKILFDALIN GT:EXON 1|1-304:0| BL:SWS:NREP 1 BL:SWS:REP 19->226|PARB_VIBCH|6e-26|34.0|200/293| BL:PDB:NREP 1 BL:PDB:REP 49->177|1vz0H|2e-20|42.7|124/187| RP:PDB:NREP 1 RP:PDB:REP 39->138|3cyiA|1e-17|23.2|99/107| RP:PFM:NREP 2 RP:PFM:REP 49->130|PF02195|2e-10|40.7|81/89|ParBc| RP:PFM:REP 162->226|PF08535|8e-05|30.8|65/84|KorB| HM:PFM:NREP 2 HM:PFM:REP 158->250|PF08535|2.8e-29|38.9|90/93|KorB| HM:PFM:REP 48->136|PF02195|7.2e-23|42.5|87/90|ParBc| GO:PFM:NREP 1 GO:PFM GO:0003677|"GO:DNA binding"|PF02195|IPR003115| RP:SCP:NREP 1 RP:SCP:REP 45->230|1vk1A|1e-25|15.8|184/232|d.268.1.2| HM:SCP:REP 44->180|1vk1A_|1e-26|34.3|137/232|d.268.1.2|1/1|ParB/Sulfiredoxin| HM:SCP:REP 129->244|1r71A_|4.5e-17|28.1|114/0|a.4.14.1|1/1|KorB DNA-binding domain-like| OP:NHOMO 966 OP:NHOMOORG 721 OP:PATTERN -------------1----------------------------------------------------2- 2211111111111111112-111111111111111121111111211111213221111111111112311111111111111-----2312-1111--111111-11111111111111111111111111111111112---12323--------------1--1-12-------------34322111222222222222222222222222222222222222222223222222222222222222221222222222222222222111111111111111111111111111111111111131111111111111222222222222224222221111221111411112212321122221--111111111111-11121211111111111111111-1111111211211111111111111111111112111112222222211111-1111-11111111111111111111111-11111411111112111112111111111111111231231112211123-13112-11311121111111111212121211-1111111111112111212231111-1111111111111111111111111123121111111111111111111111111111--12111---------------------------------------------1----------------------------------------1-----122212232212111---------------1121211111111111111211111121111111111112111111111111111111111113223--114433431111111121------------------------------------211 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 57.9 SQ:SECSTR ######################################cccccEEEEEEEGGGEEcccccccccHHHHHHHHHHHHHcGGGcccEEEcTTccEEEEccccHHHHHHHHHTTccEEEEEEEEcHHHHHHHHGGGccccccTTccHHHHHHHHHHHHHTTTccHHHHHHHHTccHHHHHHHHGGGcccHHHHHHHHTTccccHHHHHHHHHcHHHH########################################################################################## PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcHHHHccccccccccHHHHHHHHHHHHHccccccEEEEEEccccEEEEEEcHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccEEEEcccccEEEEEEEccHHHHHHHHHHHHcc //