[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : pgm
DDBJ      :pgm          phosphoglucomutase
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  455/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
c.84.1d.129.2
:544 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->544 1c47A PDBj e-158 53.5 %
:RPS:PDB   1->544 1c47A PDBj e-131 54.8 %
:RPS:SCOP  1->196 1c47A1  c.84.1.1 * 5e-39 55.4 %
:RPS:SCOP  186->290 1k2yX2  c.84.1.1 * 4e-18 29.2 %
:RPS:SCOP  294->409 1c47A3  c.84.1.1 * 8e-27 59.5 %
:RPS:SCOP  410->544 1c47A4  d.129.2.1 * 6e-25 48.5 %
:HMM:SCOP  1->214 1kfiA1 c.84.1.1 * 1.3e-54 36.1 %
:HMM:SCOP  184->293 1kfiA2 c.84.1.1 * 9e-34 42.7 %
:HMM:SCOP  279->415 1kfiA3 c.84.1.1 * 3e-41 35.8 %
:HMM:SCOP  410->544 3pmgA4 d.129.2.1 * 2.3e-50 57.8 %
:RPS:PFM   15->134 PF02878 * PGM_PMM_I 8e-12 41.2 %
:RPS:PFM   186->290 PF02879 * PGM_PMM_II 1e-12 39.0 %
:RPS:PFM   297->403 PF02880 * PGM_PMM_III 3e-13 36.4 %
:RPS:PFM   462->501 PF00408 * PGM_PMM_IV 3e-04 40.5 %
:HMM:PFM   14->153 PF02878 * PGM_PMM_I 1e-37 35.1 134/138  
:HMM:PFM   296->408 PF02880 * PGM_PMM_III 9.1e-33 37.4 107/111  
:HMM:PFM   186->287 PF02879 * PGM_PMM_II 7.4e-16 30.3 99/105  
:HMM:PFM   445->519 PF00408 * PGM_PMM_IV 9.4e-15 41.1 56/73  
:BLT:SWISS 3->544 PGM_RHIRD 0.0 62.4 %
:PROS 107->116|PS00710|PGM_PMM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30571.1 GT:GENE pgm GT:PRODUCT phosphoglucomutase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 626548..628182 GB:FROM 626548 GB:TO 628182 GB:DIRECTION + GB:GENE pgm GB:PRODUCT phosphoglucomutase GB:PROTEIN_ID ACD30571.1 GB:DB_XREF GI:187712274 GB:GENE:GENE pgm LENGTH 544 SQ:AASEQ MAIQTVSTKPFANQKPGTSGLRNKVIAFQQPRYLENFVQSIFNSLDDIEGKTLVVGGDGRYYNDVAIQIIVRMAAANGFAKIIVGQNGIFSTPAVSCVIRKYEAFGGIVLSASHNPGGPKGDFGIKYNVSNGGPAPEKITDRIFSETKKINQYFISDAAKESVDLDKLGTYKIENTTVEVINSVIDYAELMQQIFDFDKVRELFAKGFKVRFDSMCAVSGPYAKYIFETLLKAPAGTVVNAQPLEDFGGFHPDPNPVNAEDLVKHMRSGKYDFGAASDGDADRNMIVGKQIDVSPSDSLAIMAANAHLIPVYSKGIKGVARSMPTSTAVDRVAESLRLPCFETPTGWKFFGNLLDAEKITLCGEESYGTGSNHIREKDGVWAVLFWLNLVAVTGKQVDQLVEEHWQKFGRNFYSRHDYEAIDTAIANSIIDSLRERLSSLVGAQLNDEKVAKADDFSYIDPIDGLVSNHQGIRIIFEDGSRIVFRLSGTGTQGATLRIYLEKYESDSSKFSIPTQQALASLIEIAEDLTNIKSLTGMTEPTVVT GT:EXON 1|1-544:0| BL:SWS:NREP 1 BL:SWS:REP 3->544|PGM_RHIRD|0.0|62.4|540/542| PROS 107->116|PS00710|PGM_PMM|PDOC00589| BL:PDB:NREP 1 BL:PDB:REP 3->544|1c47A|e-158|53.5|540/561| RP:PDB:NREP 1 RP:PDB:REP 1->544|1c47A|e-131|54.8|542/561| RP:PFM:NREP 4 RP:PFM:REP 15->134|PF02878|8e-12|41.2|114/137|PGM_PMM_I| RP:PFM:REP 186->290|PF02879|1e-12|39.0|100/103|PGM_PMM_II| RP:PFM:REP 297->403|PF02880|3e-13|36.4|107/114|PGM_PMM_III| RP:PFM:REP 462->501|PF00408|3e-04|40.5|37/76|PGM_PMM_IV| HM:PFM:NREP 4 HM:PFM:REP 14->153|PF02878|1e-37|35.1|134/138|PGM_PMM_I| HM:PFM:REP 296->408|PF02880|9.1e-33|37.4|107/111|PGM_PMM_III| HM:PFM:REP 186->287|PF02879|7.4e-16|30.3|99/105|PGM_PMM_II| HM:PFM:REP 445->519|PF00408|9.4e-15|41.1|56/73|PGM_PMM_IV| GO:PFM:NREP 8 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02878|IPR005844| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF02878|IPR005844| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02879|IPR005845| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF02879|IPR005845| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02880|IPR005846| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF02880|IPR005846| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00408|IPR005843| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF00408|IPR005843| RP:SCP:NREP 4 RP:SCP:REP 1->196|1c47A1|5e-39|55.4|186/190|c.84.1.1| RP:SCP:REP 186->290|1k2yX2|4e-18|29.2|96/104|c.84.1.1| RP:SCP:REP 294->409|1c47A3|8e-27|59.5|116/117|c.84.1.1| RP:SCP:REP 410->544|1c47A4|6e-25|48.5|134/141|d.129.2.1| HM:SCP:REP 1->214|1kfiA1|1.3e-54|36.1|191/203|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 184->293|1kfiA2|9e-34|42.7|110/118|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 279->415|1kfiA3|3e-41|35.8|120/120|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 410->544|3pmgA4|2.3e-50|57.8|135/141|d.129.2.1|1/1|Phosphoglucomutase, C-terminal domain| OP:NHOMO 889 OP:NHOMOORG 669 OP:PATTERN -----------------1------1111111-1-2--------------111-21112-1-111--1- 221--1111111----111-11---111111-----1111--111-2-111111111---11-2---111-11111111-1--11111--------------------------------1111-11111211122-----1112-222122211221111112121112221222221221221-11--3---11111111-111121-2----111-2-111-1111111----------------------1------1-1--11---1--1--------111-11---------------------------------12--111111121111-1111---111-----11--211--11111-2---11--11111111-11-1---1111111111111111-11111111-1-1111111111111-----11111111--11111111-11--1-1-------------------------------11----------------------------------------1-----1-1----1-111----------11--1-11-11--111111-22222222211111111----------------------11-111111-1111-11----111----1-1--11---1--1-------1111111111111111-1111111111111--1--111111-111111111111111111111111112-111111111111-------------1---1---11-1--------111111----------1-1--11111---111211211112222222222222----------------1-----11-------1-------1--------------------21--111111--- --12221-21--1111111111111111111111111111111111111111111111111111111111221112213211111111-12111111111121113-13125433232222222452526H3-7132223222322222222212322211312132111211212111H1111242541322211112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 544 STR:RPRED 100.0 SQ:SECSTR cccEEEEccccTTccccTTcEEEEHHHHHHTTHHHHHHHHHHHTccHHTTcEEEEEEcccTTHHHHHHHHHHHHHHHTccEEEEEEEEEccHHHHHHHHHHHTccEEEEEccTTccccTTcEEEEEEEETTcccccHHHHHHHHHHHHHccEEEEcTTEEccccTTccEEEEEccEEEEEEcccHHHHHHHHHHccHHHHHHHHHccccEEEEcTTcTHHHHHHHHTTTTTcccGGGEETccccTTTTTccccccTTTTHHHHHHHHTccccEEEEEccccccEEEEEGGGcccHHHHHHHHHHcGGGcHHHHHccccEEEETTccTHHHHHHHTTTccEEEEcccTHHHHHHHHTTcccEEEETTTEEEETTcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHccEEEEEEEEEEEEcHHHHHHHHHHHHHHHTcTEEETTEEEEEEEEEEccEEcTTTccEEccccEEEEETTccEEEEEEEEcccccEEEEEEEEEEEccTTGGGccHHHHHHHHHHHHHHHHTHHHHHccccccEEc PSIPRED ccccccccccccccccccccccHHHcccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEccccEEcHHHHHHHHHHccccEEEEEEEEccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHccccccccccEEEEcHHHHHHHHHHHHccHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHccccccEEEEEEEcccccccccccccccHHHHHHHHHHccccEEEEEcccccEEEEEccccEEEcHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHcccEEEEEccccHHHHHHHHHcccEEEEEcccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccEEcccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccccccccEEEEEcccEEEEEEcccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //