[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : phnA
DDBJ      :phnA         phosphonoacetate hydrolase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  434/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.34.11
:89 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->89 2aklA PDBj 2e-22 51.7 %
:RPS:PDB   20->88 2akkA PDBj 7e-28 47.8 %
:RPS:SCOP  20->88 2akkA1  b.34.11.2 * 6e-28 47.8 %
:HMM:SCOP  16->89 2aklA1 b.34.11.2 * 1.9e-28 63.5 %
:RPS:PFM   21->75 PF03831 * PhnA 2e-17 81.8 %
:HMM:PFM   21->75 PF03831 * PhnA 8.2e-30 76.4 55/56  
:HMM:PFM   2->12 PF10571 * UPF0547 3.3e-06 36.4 11/26  
:BLT:SWISS 2->88 PHNA_SHIFL 5e-34 72.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31030.1 GT:GENE phnA GT:PRODUCT phosphonoacetate hydrolase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1222061..1222330) GB:FROM 1222061 GB:TO 1222330 GB:DIRECTION - GB:GENE phnA GB:PRODUCT phosphonoacetate hydrolase GB:PROTEIN_ID ACD31030.1 GB:DB_XREF GI:187712733 GB:GENE:GENE phnA LENGTH 89 SQ:AASEQ MICPECGYEWQADEISSNELVIRDSNGNSLADGDSVAIIKDLKLKGSSQVIKVGTKVKNIRLVIGDHDIDCKIDGFGAIQLKSQFVKKV GT:EXON 1|1-89:0| BL:SWS:NREP 1 BL:SWS:REP 2->88|PHNA_SHIFL|5e-34|72.4|87/111| BL:PDB:NREP 1 BL:PDB:REP 1->89|2aklA|2e-22|51.7|89/116| RP:PDB:NREP 1 RP:PDB:REP 20->88|2akkA|7e-28|47.8|69/74| RP:PFM:NREP 1 RP:PFM:REP 21->75|PF03831|2e-17|81.8|55/55|PhnA| HM:PFM:NREP 2 HM:PFM:REP 21->75|PF03831|8.2e-30|76.4|55/56|PhnA| HM:PFM:REP 2->12|PF10571|3.3e-06|36.4|11/26|UPF0547| RP:SCP:NREP 1 RP:SCP:REP 20->88|2akkA1|6e-28|47.8|69/72|b.34.11.2| HM:SCP:REP 16->89|2aklA1|1.9e-28|63.5|74/0|b.34.11.2|1/1|Prokaryotic SH3-related domain| OP:NHOMO 446 OP:NHOMOORG 436 OP:PATTERN -------------------------------------------------------------------- ------1-111--------------------------1--------1-------1--------------------------------------------112----11-----------------11-11-111-1----------------------------------------------------------111111121111211----1-111---1-111111111-1--------------1---11----------------------1111111111111111111111111111-111111111-11111111--1---------1-1-1--1111--------------------------11-11111-11-1--111---111111111111-111-11111111--1-2111111221-111111--11111-1111111111-1111111-------------------------------13-1-----11111111111--11111111111--1111--11----1121--11--211111111111---1111-----1--11----111111111----1------1-11111-1-1111111-111111--111-111-1-----111----1-11----------------11111111111111-11-1111111111111111111111111111111111111111111111111111-111111111111---------1-111---111111111111111111111111111111111111111111111111111111--11------1-1--1111111111------1-----------------1-------------------------------------- -------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 89 STR:RPRED 100.0 SQ:SECSTR EEETTTTEEEcTTccccccccccccccccccTTEEEEEcccEEETTTTEEEcTTcEEEEEEEcccccEEEEEccccEEEEEETTcEEEc DISOP:02AL 89-90| PSIPRED ccccccccccccccccccccEEEEccccccccccEEEEEEEEccccccccEEEccEEEEEEEcccccEEEEEEcccccEEEEEEEEEEc //