[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ppnK
DDBJ      :ppnK         NAD kinase
Swiss-Prot:PPNK_FRATM   RecName: Full=Probable inorganic polyphosphate/ATP-NAD kinase;         Short=Poly(P)/ATP NAD kinase;         EC=2.7.1.23;

Homologs  Archaea  64/68 : Bacteria  815/915 : Eukaryota  166/199 : Viruses  0/175   --->[See Alignment]
e.52.1
:296 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   24->296 2an1A PDBj 1e-52 45.6 %
:RPS:PDB   7->296 2an1A PDBj 1e-43 40.8 %
:RPS:SCOP  26->291 1u0rA  e.52.1.1 * 3e-61 32.3 %
:HMM:SCOP  6->298 1u0tA_ e.52.1.1 * 2.6e-76 37.5 %
:RPS:PFM   49->267 PF01513 * NAD_kinase 8e-37 41.3 %
:HMM:PFM   7->274 PF01513 * NAD_kinase 3.8e-57 34.7 262/285  
:BLT:SWISS 1->296 PPNK_FRATM e-167 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31293.1 GT:GENE ppnK GT:PRODUCT NAD kinase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1580513..1581403) GB:FROM 1580513 GB:TO 1581403 GB:DIRECTION - GB:GENE ppnK GB:PRODUCT NAD kinase GB:PROTEIN_ID ACD31293.1 GB:DB_XREF GI:187712996 GB:GENE:GENE ppnK LENGTH 296 SQ:AASEQ MAFKYHKVAIVGKHYKKEVSQMVETLYAYLQQQGLEIIIENDTAADTSLVNVAIASLKEIALRCDVAIVVGGDGNFLKASRLLALYSNIPVIGINKGKLGFLTTLAADDNALKNDLYAILKGDSSVTKMSMLKYRVDNNLRAPLEASIALNEIAITASRGLMFGLKVFIDGRYAFDQRGDGLIVSTPTGSTAHAMSAGGPILNPNQNSVVLVPICSHSLNSRPLVISDESVIDIYITDYNDPEPVLSIDGRHDTILKAHQKVTIQKARKKVTVLHTKDYNYYDTLREKLGWSKVLF GT:EXON 1|1-296:0| SW:ID PPNK_FRATM SW:DE RecName: Full=Probable inorganic polyphosphate/ATP-NAD kinase; Short=Poly(P)/ATP NAD kinase; EC=2.7.1.23; SW:GN Name=ppnK; OrderedLocusNames=FTM_1468; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase; NAD; NADP;Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->296|PPNK_FRATM|e-167|100.0|296/296| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 24->296|2an1A|1e-52|45.6|261/275| RP:PDB:NREP 1 RP:PDB:REP 7->296|2an1A|1e-43|40.8|272/275| RP:PFM:NREP 1 RP:PFM:REP 49->267|PF01513|8e-37|41.3|213/240|NAD_kinase| HM:PFM:NREP 1 HM:PFM:REP 7->274|PF01513|3.8e-57|34.7|262/285|NAD_kinase| GO:PFM:NREP 2 GO:PFM GO:0003951|"GO:NAD+ kinase activity"|PF01513|IPR002504| GO:PFM GO:0008152|"GO:metabolic process"|PF01513|IPR002504| RP:SCP:NREP 1 RP:SCP:REP 26->291|1u0rA|3e-61|32.3|257/281|e.52.1.1| HM:SCP:REP 6->298|1u0tA_|2.6e-76|37.5|288/302|e.52.1.1|1/1|NAD kinase| OP:NHOMO 1373 OP:NHOMOORG 1045 OP:PATTERN 11-11-11111111111211-21111111111111111111111111111111111111111111-11 1111211111111111111-1111111111111111111112112111111111111111221111122111111111111111111111111111---11111111111--------------11111111111111111111112222222222222222222222222222222222222-----11112222222222222222212222222222212211111112121111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111-----1----11111111111-------111-11111111111-11--11--11----11---------111111111111111111--111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111---11111111------1111111111---------1---1----111-----1111111111111 --11222----133433333333323333333333333333333233333323133333333322222223322233-3322222234-23132225332132434-11-2332232-11--1-421-1491--11-1-11-11--11--1-----3-111211111A-13--212331E3222242453331121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 292 STR:RPRED 98.6 SQ:SECSTR ####ccEEEEEcccHHHHHHHHHHTHHHHHHHTTcEEEEEHHHHHHTTcccccEEcHHHHHHHccEEEEcccHHHHHHHHHHHTTccccEEEEcccccccccccccTTcHHHHHHHHHHHTTcEEEEEEEEEEEEEEcccEEEEccEEEEEEccTTccccccEEEEEEETTEEEEEEEEcEEEEEcTGGGGTHHHHTTcccccTTccEEEEEEEccccTTcccEEEETTccEEEEEcEcccccEEEEETTcccEEEcTTcEEEEEEEEEEEEEEEETTccHHHHHHHHHTcccccc PSIPRED ccccccEEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEccHHHHccccccccccHHHccccccEEEEEcccHHHHHHHHHHcccccccEEEEEcccccccccccccccHHHHHHHHHHccccEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEcccccEEEEEEEEccEEEEEEEccEEEEEccccHHHHHHHccccEEcccccEEEEEEEccccccccEEEEccccEEEEEEccccccEEEEEEcccEEEEEccccEEEEEEcccEEEEEEEccccHHHHHHHHcccccccc //