[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : purK
DDBJ      :purK         N5-carboxyaminoimidazole ribonucleotide synthase monomer
Swiss-Prot:             

Homologs  Archaea  44/68 : Bacteria  722/915 : Eukaryota  122/199 : Viruses  0/175   --->[See Alignment]
b.84.2c.30.1d.142.1
:365 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->355 1b6sB PDBj 6e-43 36.7 %
:RPS:PDB   13->266 3d2oA PDBj 9e-38 12.8 %
:RPS:SCOP  97->295 1b6rA3  d.142.1.2 * 2e-27 33.3 %
:RPS:SCOP  300->340 1eyzA1  b.84.2.1 * 8e-04 14.6 %
:HMM:SCOP  1->96 1b6rA2 c.30.1.1 * 9.5e-18 42.9 %
:HMM:SCOP  97->297 1b6rA3 d.142.1.2 * 2.3e-53 39.8 %
:HMM:SCOP  297->360 1b6rA1 b.84.2.1 * 4.5e-12 36.5 %
:RPS:PFM   106->273 PF02222 * ATP-grasp 1e-38 46.4 %
:HMM:PFM   106->275 PF02222 * ATP-grasp 5e-54 43.5 168/172  
:BLT:SWISS 1->364 PURK_VIBCH 1e-64 40.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30504.1 GT:GENE purK GT:PRODUCT N5-carboxyaminoimidazole ribonucleotide synthase monomer GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 530712..531809 GB:FROM 530712 GB:TO 531809 GB:DIRECTION + GB:GENE purK GB:PRODUCT N5-carboxyaminoimidazole ribonucleotide synthase monomer GB:PROTEIN_ID ACD30504.1 GB:DB_XREF GI:187712207 GB:GENE:GENE purK LENGTH 365 SQ:AASEQ MKIGIIGAGQLARMLSLAGTPLGLEFHCLGKNGDCAEEVVKTVTDIELTKVNDVVAWAKQFDVITFENENISHELIKAINHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLQSAVDDHGLPAILKTRRFGYDGKGQFVIRSQEDITKAWDVLKDAPDGLIYEAFVDFDYEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFENVVLAEKAQQIAKILVKEFAYVGTLAIEFFVKGDEIIVNEIAPRVHNSGHWSIDGAVTSQFENHVRAIARLILGDTTSRKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQAKKLIALSEEI GT:EXON 1|1-365:0| BL:SWS:NREP 1 BL:SWS:REP 1->364|PURK_VIBCH|1e-64|40.1|357/377| BL:PDB:NREP 1 BL:PDB:REP 2->355|1b6sB|6e-43|36.7|327/355| RP:PDB:NREP 1 RP:PDB:REP 13->266|3d2oA|9e-38|12.8|227/244| RP:PFM:NREP 1 RP:PFM:REP 106->273|PF02222|1e-38|46.4|166/171|ATP-grasp| HM:PFM:NREP 1 HM:PFM:REP 106->275|PF02222|5e-54|43.5|168/172|ATP-grasp| RP:SCP:NREP 2 RP:SCP:REP 97->295|1b6rA3|2e-27|33.3|189/192|d.142.1.2| RP:SCP:REP 300->340|1eyzA1|8e-04|14.6|41/74|b.84.2.1| HM:SCP:REP 1->96|1b6rA2|9.5e-18|42.9|77/0|c.30.1.1|1/1|PreATP-grasp domain| HM:SCP:REP 97->297|1b6rA3|2.3e-53|39.8|196/198|d.142.1.2|1/1|Glutathione synthetase ATP-binding domain-like| HM:SCP:REP 297->360|1b6rA1|4.5e-12|36.5|63/79|b.84.2.1|1/1|Rudiment single hybrid motif| OP:NHOMO 1214 OP:NHOMOORG 888 OP:PATTERN --1---2222222221-111111-11112111---11111111-----------12112-2111--11 1-11121222222231111-131113111111322212221---1111111111111111111111111112222212----112-221111-1-----11221111111---------------11-111---1111111---11211211111112222222211111122221112222211111---1121111111111111111111121111111111111111121111111111111111111121112212-1-22222222211111111111111111111111111111111111111111111111111111-------------------------1---1-------1--11-1---1-1111211111111111111111111111111111-11111111112111111111111111111111111111111111111111111211111111111---------------111112121122222222222222222222222222222222211111212112222212122222121111111111122------21-11111-11111-11111-111--1-------------------11111222221211111222222121222212112111-1-112------22222222221222222-22222222222222222212222211222222222222222222222222222222222222222--12-----111122211222222211111222222222211121222222222222222222222222222222122222222222222222222111111--222222------------------------------------1----1-1111-- ----111-----1111111111111111111211111111111111111111111111111111111111111111111111111111-1111111111111111--12------------------------------------------------------1---------1--11181111121121121111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 363 STR:RPRED 99.5 SQ:SECSTR EEEEEEccccccccccEEHHEEEEEEEEEEEETTEEEEEEEEEEEcTTcccHccccTHHHHHHHHHccccccHHHHHHHHHHHHTTccEEEEEEEEEEEEEEEcHTTTccEEEEEEEEEEEEEEETTEEEEEEEEEEEEETTEEcHHHHHHccccccEEEEEEEEEHHTccEEEcccccHHHHHHHHEEEcTTHTTccEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcTTEEEEEEEEEETTccEEEEccTTccccHHHHHHHHHcccHHHHHHHHHTTccGGGcccTTTTTccccccccccccEEEEEEccGGGcccccccccccEEEEccEEEccHHHHHHHHHHHHHHHH## PSIPRED cEEEEEcccHHHHHHHHHHHHcccEEEEEccccccccHHHHEEcccccccHHHHHHHHHHccEEEEccccccHHHHHHHccccEEcccHHHHHHHHcHHHHHHHHHHcccccccccccccHHHHHHHHHHccccEEEEEcccccccccEEEEccHHHHHHHHHHHHccccEEEEEEEccccEEEEEEEEEcccccEEEEccccEEEEcccEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEccEEEEEEEccccccccEEEEEEccccHHHHHHHHHHccccccHHccccEEEEEEcccccHHHHHcccccEEEEEccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHcc //