[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : purM
DDBJ      :purM         phosphoribosylformylglycinamidine cyclo-ligase
Swiss-Prot:             

Homologs  Archaea  60/68 : Bacteria  812/915 : Eukaryota  180/199 : Viruses  1/175   --->[See Alignment]
d.139.1d.79.4
:347 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   14->330 2btuA PDBj 5e-71 43.8 %
:RPS:PDB   3->347 1cliA PDBj 1e-68 42.4 %
:RPS:SCOP  3->170 1cliA1  d.79.4.1 * 2e-44 46.7 %
:RPS:SCOP  171->347 1cliA2  d.139.1.1 * 2e-31 38.4 %
:HMM:SCOP  2->170 1cliA1 d.79.4.1 * 3.1e-44 39.2 %
:HMM:SCOP  171->348 1cliA2 d.139.1.1 * 1.9e-48 43.9 %
:RPS:PFM   91->142 PF00586 * AIRS 1e-09 53.8 %
:HMM:PFM   176->347 PF02769 * AIRS_C 1.3e-28 27.9 147/151  
:HMM:PFM   49->142 PF00586 * AIRS 4.4e-20 38.8 85/96  
:BLT:SWISS 4->341 PUR5_THEP3 5e-88 49.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30500.1 GT:GENE purM GT:PRODUCT phosphoribosylformylglycinamidine cyclo-ligase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 526166..527209 GB:FROM 526166 GB:TO 527209 GB:DIRECTION + GB:GENE purM GB:PRODUCT phosphoribosylformylglycinamidine cyclo-ligase GB:PROTEIN_ID ACD30500.1 GB:DB_XREF GI:187712203 GB:GENE:GENE purM LENGTH 347 SQ:AASEQ MAGLKYEDAGVNIEAGNQAVERMKQHVKKTFTQDVLTGLGSFGSLYSLKNIINNYDDPVLVQSIDGVGTKTKVAVMCGKFENLGYDLFSAATNDIVVMGAKPITFLDYVAHDKLDPAIMEELVKGMSKACAECGVSLVGGETAEMPGVYQAGEIDMVGVITGIVDRKGIINGENVKEGDIVFGLSSSGLHTNGYSFARKLFFDVAGNKHTDTYPELEGKTIGDVLLEPHINYTNIIHDFLDNGVDIKGMAHITGGGFIENIPRVLPQGLGAQIDKDSFATPAIFKLMQRIGDISEFEMYRSFNMGIGMTIIASQDQFDKMQELAKKHTNTKLYQIGKITNSGKVEII GT:EXON 1|1-347:0| BL:SWS:NREP 1 BL:SWS:REP 4->341|PUR5_THEP3|5e-88|49.4|330/336| BL:PDB:NREP 1 BL:PDB:REP 14->330|2btuA|5e-71|43.8|306/322| RP:PDB:NREP 1 RP:PDB:REP 3->347|1cliA|1e-68|42.4|337/341| RP:PFM:NREP 1 RP:PFM:REP 91->142|PF00586|1e-09|53.8|52/97|AIRS| HM:PFM:NREP 2 HM:PFM:REP 176->347|PF02769|1.3e-28|27.9|147/151|AIRS_C| HM:PFM:REP 49->142|PF00586|4.4e-20|38.8|85/96|AIRS| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00586|IPR000728| RP:SCP:NREP 2 RP:SCP:REP 3->170|1cliA1|2e-44|46.7|165/166|d.79.4.1| RP:SCP:REP 171->347|1cliA2|2e-31|38.4|172/175|d.139.1.1| HM:SCP:REP 2->170|1cliA1|3.1e-44|39.2|166/0|d.79.4.1|1/1|PurM N-terminal domain-like| HM:SCP:REP 171->348|1cliA2|1.9e-48|43.9|173/175|d.139.1.1|1/1|PurM C-terminal domain-like| OP:NHOMO 1125 OP:NHOMOORG 1053 OP:PATTERN --11--1111111111-111111111111111111222122211111111111111111-1111--11 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111--1----1---11111---11----------------1111111111111111111111111111111111111111111111111111111111111113111111111111111111111111111111111111111111111111111111111111111111-11111-1-1111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111121111111---------------1111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111-1-------11111111111111111111111111111111111111-11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--------1---------------------------1-11111111111 ----111-----11111111111111111111111111111111111111111111111111111111111111111-1111111111-12111111111111111-12-2121214111111111111391-113-1111-11-1111-111215222253111-111163112111182111121321231121111 -----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 345 STR:RPRED 99.4 SQ:SECSTR ##cTTTccccccTTHHHHHHHHTHHHHHTTccTTEEccccccccEEcccTHcTTcccEEEEEEEEEccTHHHHHHHTTccccHHHHHHHHHHHHHGGGTcEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHTcEEEEEEEEEcTTTccTTcEEEEEEEEEEEEGGGccccTTccTTcEEEEEEccccTTccHHHHHHHHHHTTccTTTccccccccccHHHHHHccccccHHHHHHHHHHcHcccEEEEccTTHHHHHGGGcccTTEEEEEcGGGccccHHHHHHHHHHTccHHHHHHHccTTEEEEEEEcGGGHHHHHHHHHTTTTccEEEEEEEEEcccccEE PSIPRED cccccHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccEEEcccHHHccccccEEEEEcccccccEEcccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccEEEccEEEEcccccccccEEEEEEEEEEEEHHHcccHHHcccccEEEEEccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHccHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHcccEEEEEcHHccccHHHHHHHHHccccHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHccccEEEEEEEEEEccccEEc //