[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : pyrB
DDBJ      :pyrB         aspartate carbamoyltransferase
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  851/915 : Eukaryota  186/199 : Viruses  1/175   --->[See Alignment]
c.78.1
:306 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   7->304 3e2pK PDBj 1e-73 48.0 %
:RPS:PDB   7->304 3e2pA PDBj 2e-82 49.7 %
:RPS:SCOP  1->150 1a1sA1  c.78.1.1 * 1e-45 39.2 %
:RPS:SCOP  151->303 1a1sA2  c.78.1.1 * 1e-22 19.3 %
:HMM:SCOP  1->304 1tugA1 c.78.1.1 * 2.3e-85 38.3 %
:RPS:PFM   7->145 PF02729 * OTCace_N 2e-32 51.1 %
:RPS:PFM   155->303 PF00185 * OTCace 1e-07 30.3 %
:HMM:PFM   6->147 PF02729 * OTCace_N 5.5e-50 51.4 140/142  
:HMM:PFM   153->303 PF00185 * OTCace 3.6e-29 29.7 145/158  
:BLT:SWISS 1->304 PYRB_PICTO 1e-73 49.2 %
:PROS 50->57|PS00097|CARBAMOYLTRANSFERASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30125.1 GT:GENE pyrB GT:PRODUCT aspartate carbamoyltransferase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(8004..8924) GB:FROM 8004 GB:TO 8924 GB:DIRECTION - GB:GENE pyrB GB:PRODUCT aspartate carbamoyltransferase GB:PROTEIN_ID ACD30125.1 GB:DB_XREF GI:187711828 GB:GENE:GENE pyrB LENGTH 306 SQ:AASEQ MLSFQKLLRGDQITKDDLFKLFHQADIYKNKLANSEPIKDLEGKILASLFFEPSTRTRFSFESAMNRLGGKVISLENGSSSSTQKGETLDDTGRMIDQYADIIVMRHPKPHSVEEFSKYVNSPVINAGDGENEHPTQSLVDLYTIYSEKGSLDNLKVGFLGDLKYGRTVHSLTNILAKYNASFKFISSKELQIPKKLKDFIIKNGNSFIELDKVSADVLEDLDVLYVTRVQRERFPDEESYLKNKDLCYLDRKHIFPRSNFIILHPLPRVDEMDRSIDELECAKYFEQIKYSIPIRMALLALLVIS GT:EXON 1|1-306:0| BL:SWS:NREP 1 BL:SWS:REP 1->304|PYRB_PICTO|1e-73|49.2|297/304| PROS 50->57|PS00097|CARBAMOYLTRANSFERASE|PDOC00091| BL:PDB:NREP 1 BL:PDB:REP 7->304|3e2pK|1e-73|48.0|296/305| RP:PDB:NREP 1 RP:PDB:REP 7->304|3e2pA|2e-82|49.7|296/306| RP:PFM:NREP 2 RP:PFM:REP 7->145|PF02729|2e-32|51.1|137/142|OTCace_N| RP:PFM:REP 155->303|PF00185|1e-07|30.3|145/157|OTCace| HM:PFM:NREP 2 HM:PFM:REP 6->147|PF02729|5.5e-50|51.4|140/142|OTCace_N| HM:PFM:REP 153->303|PF00185|3.6e-29|29.7|145/158|OTCace| GO:PFM:NREP 5 GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF02729|IPR006132| GO:PFM GO:0016743|"GO:carboxyl- or carbamoyltransferase activity"|PF02729|IPR006132| GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF00185|IPR006131| GO:PFM GO:0016597|"GO:amino acid binding"|PF00185|IPR006131| GO:PFM GO:0016743|"GO:carboxyl- or carbamoyltransferase activity"|PF00185|IPR006131| RP:SCP:NREP 2 RP:SCP:REP 1->150|1a1sA1|1e-45|39.2|148/150|c.78.1.1| RP:SCP:REP 151->303|1a1sA2|1e-22|19.3|150/163|c.78.1.1| HM:SCP:REP 1->304|1tugA1|2.3e-85|38.3|298/0|c.78.1.1|1/1|Aspartate/ornithine carbamoyltransferase| OP:NHOMO 2147 OP:NHOMOORG 1105 OP:PATTERN 22323222222222222221111222222222222222222221222222222222222222224-22 2421222233222222222-2222222222224222222222222122222222222211326222222222222222225432222211111111---11112111111---------------2222222222222222222222222222222233322322222222222222222222222222212222222233232233322233223322222223233322221333333334333344432231111112111222211313221211222-111132111111111111111111111111122222222122124333333333322222222212422323222222221232222212223322222111222222222222222222222222-22222222223222222322223322122222222222222222222222222221112222211---------------111122222223332433333333333344444434335222222222223222222322222222332222222222222122222322222222222222222222212222222222222112111111122222223322222322222222225222222222221-2322321-22224222212111211111-11211111111111111121112222223222122222222223111111121222221222222111211111222222323111111111-1---122222222222233333333333334223211111111222232222221422112222222111112223112211111111112---------12-1------121-----2233322222222 11--112-3111111112-122221211111111211111-111112211121211211112222211221-12211-1112221222-11111111111221354-23151322431121121432214A2-222122221221-221-21-21121312313211111611312222F2222241231222222222 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--- STR:NPRED 304 STR:RPRED 99.3 SQ:SECSTR ccTTcccccGGGccHHHHHHHHHHHHHHHHHHHHcccccTTTTcEEEEEEccccHHHHHHHHHHHHHTTcEEEEEccTTcHHHHTTccHHHHHHHHHHHccEEEEEcccccHHHHHHHHccccEEEccccccccHHHHHHHHHHHHHHHccccccEEEEEccTTTcHHHHHHHHHHTTcTcEEEEEcccTTcccHHHHHHHHHTTccEEEEccGGcGccTTccEEEEccccGGGcccHHHHHHHHHHHcccHHHHTHTcccEEEccccccccccGGGTTcTTccHHHHHHHHHHHHHHHHHHHH## PSIPRED cccccccccHHHccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEccccHHHHHHHHHHHHccccEEEEcccccccccccccHHHHHHHHHHHccEEEEEcccHHHHHHHHHHccccEEEccccccccHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHcccEEEEEccHHHHHccccEEEEccHHccccccHHHHHHHHHHHHHHHHHHccccccEEEccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHcc //