[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rhtB
DDBJ      :rhtB         homoserine/threonine efflux family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  98/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:211 amino acids
:PSIPRED
:RPS:PFM   12->172 PF01810 * LysE 2e-07 25.8 %
:HMM:PFM   13->208 PF01810 * LysE 2.1e-28 23.0 187/192  
:BLT:SWISS 1->192 RHTC_SALTY 2e-15 28.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31292.1 GT:GENE rhtB GT:PRODUCT homoserine/threonine efflux family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1579881..1580516 GB:FROM 1579881 GB:TO 1580516 GB:DIRECTION + GB:GENE rhtB GB:PRODUCT homoserine/threonine efflux family protein GB:PROTEIN_ID ACD31292.1 GB:DB_XREF GI:187712995 GB:GENE:GENE rhtB LENGTH 211 SQ:AASEQ MLIFLTILALQISCLILPGPDFFVTISNSIKFGHKSGIYTASGVASGIFLNTFIVYWFGSLLLYKQPLLFKMLILIGAAYLAYIAFSLYKSIFTIQQLNPNANQHIKNLDNFDKPSNTKFFLNGAFTNLANAKVLVFFSSMLSLVDELNSFGKVAIWIAIALTTLVWFCIVATFFGNDKLRQVFFRNIKKIEFISAIFITIFVIVILVELF GT:EXON 1|1-211:0| BL:SWS:NREP 1 BL:SWS:REP 1->192|RHTC_SALTY|2e-15|28.4|183/206| TM:NTM 5 TM:REGION 6->28| TM:REGION 39->61| TM:REGION 68->90| TM:REGION 156->178| TM:REGION 191->211| SEG 73->85|liligaaylayia| SEG 193->208|fisaifitifvivilv| RP:PFM:NREP 1 RP:PFM:REP 12->172|PF01810|2e-07|25.8|151/190|LysE| HM:PFM:NREP 1 HM:PFM:REP 13->208|PF01810|2.1e-28|23.0|187/192|LysE| GO:PFM:NREP 2 GO:PFM GO:0006865|"GO:amino acid transport"|PF01810|IPR001123| GO:PFM GO:0016020|"GO:membrane"|PF01810|IPR001123| OP:NHOMO 105 OP:NHOMOORG 98 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------11------------------------------------1-------------------1--1-11-------1-------------------------1111-1-11--1----1-11111--1111-111111111111-1--1111111111111111-1---1---111111111111---------1111--------------------22222-1----------211---------111111111---1------121--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //