[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rluC
DDBJ      :rluC         ribosomal large subunit pseudouridine synthase C
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  903/915 : Eukaryota  148/199 : Viruses  0/175   --->[See Alignment]
d.265.1d.66.1
:309 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   90->309 1xpiB PDBj 2e-39 39.0 %
:RPS:PDB   1->234 3dpuB PDBj 3e-27 11.2 %
:RPS:SCOP  16->109 1dm9A  d.66.1.3 * 2e-09 12.6 %
:RPS:SCOP  90->309 1v9kA  d.265.1.3 * 2e-47 37.6 %
:HMM:SCOP  15->72 1vioA2 d.66.1.5 * 1.3e-06 31.6 %
:HMM:SCOP  88->311 1v9kA_ d.265.1.3 * 1.2e-57 38.3 %
:RPS:PFM   98->244 PF00849 * PseudoU_synth_2 8e-21 44.3 %
:HMM:PFM   96->246 PF00849 * PseudoU_synth_2 1e-33 32.5 151/164  
:HMM:PFM   16->62 PF01479 * S4 1.9e-08 34.0 47/48  
:BLT:SWISS 2->309 RLUC_HAEIN 3e-64 41.5 %
:PROS 135->149|PS01129|PSI_RLU
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30217.1 GT:GENE rluC GT:PRODUCT ribosomal large subunit pseudouridine synthase C GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 129164..130093 GB:FROM 129164 GB:TO 130093 GB:DIRECTION + GB:GENE rluC GB:PRODUCT ribosomal large subunit pseudouridine synthase C GB:PROTEIN_ID ACD30217.1 GB:DB_XREF GI:187711920 GB:GENE:GENE rluC LENGTH 309 SQ:AASEQ MNKVELIEVAEDVIDQRIDNFLLSRFSRLPKSLIYRWIRKGELRVNKKRVKQISRVSAGDIVRVPPFSLEEDSKPIKISQSHLDFLEQRILYENDDYIIVDKPSGMAVHGGSGVNSGLVERLRQLRPKVRRLDLVHRLDKETSGCVLLAKKHSSLVYFFDIFKQRKVDKIYYSIVHGHWDKKIIKIDLPLKRTETKDGQRVVKVDSKDGKQALTRIISVRHLQGGFSLLEIKLETGRTHQIRVHTKAMGHPIVADKKYGFATKDQLLLDKGVDRLLLHAAKLEFYDDKQNKQISVTAALDSRFEKFIQE GT:EXON 1|1-309:0| BL:SWS:NREP 1 BL:SWS:REP 2->309|RLUC_HAEIN|3e-64|41.5|306/322| PROS 135->149|PS01129|PSI_RLU|PDOC00869| SEG 181->186|kkiiki| SEG 266->277|llldkgvdrlll| BL:PDB:NREP 1 BL:PDB:REP 90->309|1xpiB|2e-39|39.0|218/229| RP:PDB:NREP 1 RP:PDB:REP 1->234|3dpuB|3e-27|11.2|223/328| RP:PFM:NREP 1 RP:PFM:REP 98->244|PF00849|8e-21|44.3|140/149|PseudoU_synth_2| HM:PFM:NREP 2 HM:PFM:REP 96->246|PF00849|1e-33|32.5|151/164|PseudoU_synth_2| HM:PFM:REP 16->62|PF01479|1.9e-08|34.0|47/48|S4| GO:PFM:NREP 4 GO:PFM GO:0001522|"GO:pseudouridine synthesis"|PF00849|IPR006145| GO:PFM GO:0003723|"GO:RNA binding"|PF00849|IPR006145| GO:PFM GO:0009451|"GO:RNA modification"|PF00849|IPR006145| GO:PFM GO:0009982|"GO:pseudouridine synthase activity"|PF00849|IPR006145| RP:SCP:NREP 2 RP:SCP:REP 16->109|1dm9A|2e-09|12.6|87/104|d.66.1.3| RP:SCP:REP 90->309|1v9kA|2e-47|37.6|218/227|d.265.1.3| HM:SCP:REP 15->72|1vioA2|1.3e-06|31.6|57/58|d.66.1.5|1/1|Alpha-L RNA-binding motif| HM:SCP:REP 88->311|1v9kA_|1.2e-57|38.3|222/0|d.265.1.3|1/1|Pseudouridine synthase| OP:NHOMO 2922 OP:NHOMOORG 1056 OP:PATTERN --------------------------------------11111------------------------- 2121121222231221111-11111211111111112333111111321111211211111112111111111111112111111222344414-311122223234424-2222222-212224111111111112221111121123122211222112213112222113111113111132311221433-3333333333333322333333333333223333334533333333333333333333-34344343334444444443333333333333333333333333333333333333333333222333332333333333333343333333334331332133141121212223132214333322222333333333333322222222223-333333332232233222222222334433332222332333333333333334222222222221122222222222222122233333222222223222222222222222222222222232224352434444244332224434443442222547131437223422124343334345555842233323333333333333323333332266644463775688888A977799-A999A2-3232322222244434554444444444-44444444444444444444444434544444444444444445444444431544444444444222422222222233535555455454554335555455534436444434444-33444332222222226777566666667664433333333222222444433332223222231211112-22212222222222121122222222222222 -1--121-211123311-1-111111--------------------1--1------1-----21221211232222322321112211-121111-1-1112121-12426343222-212131331214A3-323122-42342231-2322333233-123433-4114-11112127757-223451628563324 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 309 STR:RPRED 100.0 SQ:SECSTR TTccEEcHHHHHHHHHHHHTcGGGTTcEEEGGGHHHHHHTccGGGcccHHHHHHHHHHHHHTTccEEccccEEEcGGGcccccTTccEEEEEEEccccTTHHHHHHHHHGGGEEETcHHHHHHHHEEEETTEEEEEEGGGTTEEEEEEEETTTTEEEEEEEccHHHHHHHHHHHHHHHcTTccEEEEEEETTEEEEEEEHHHHHHHHTTccEEEETTTTEEEEEHHHHHHTTcccccTTHHHHHHHHTTccEEEEEEEEETEEEEHHTTcccTTEEcTTccTTcEEEccHHHHHHHHHTcccccGccTH PSIPRED cccEEEEEEcHHHcccHHHHHHHHHcccccHHHHHHHHHcccEEEccEEEccccEEccccEEEEcccccccccccccccccHHHHHHHHHHccccEEEEEEccccEEEcccccccccHHHHHHHHcccccEEEEEEcccccccEEEEEEccHHHHHHHHHHHHHccEEEEEEEEEEEEEcccEEEEEcccccccccccEEEEEEccccccccccEEEEEEEccccEEEEEEEEcccccHHHHHHHHHccccEEccccccccccccccccccccHHEEEEEEEEEEccccccEEEEEccccHHHHHHHcc //