[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rnc
DDBJ      :rnc          ribonuclease III
Swiss-Prot:RNC_FRATM    RecName: Full=Ribonuclease 3;         EC=3.1.26.3;AltName: Full=Ribonuclease III;         Short=RNase III;

Homologs  Archaea  9/68 : Bacteria  890/915 : Eukaryota  151/199 : Viruses  2/175   --->[See Alignment]
a.149.1d.50.1
:230 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->223 1yywC PDBj 3e-31 39.5 %
:RPS:PDB   1->221 3c4bA PDBj 1e-34 26.9 %
:RPS:SCOP  6->147 1o0wA1  a.149.1.1 * 6e-39 35.9 %
:RPS:SCOP  133->230 1whnA  d.50.1.1 * 3e-14 17.4 %
:HMM:SCOP  1->151 1jfzA_ a.149.1.1 * 5.6e-48 49.0 %
:HMM:SCOP  106->221 1whnA_ d.50.1.1 * 7.8e-21 40.2 %
:RPS:PFM   37->124 PF00636 * Ribonuclease_3 5e-18 50.0 %
:RPS:PFM   155->221 PF00035 * dsrm 2e-05 44.4 %
:HMM:PFM   37->124 PF00636 * Ribonuclease_3 8.4e-27 47.7 88/105  
:HMM:PFM   154->221 PF00035 * dsrm 6.4e-12 37.9 66/67  
:BLT:SWISS 1->230 RNC_FRATM e-126 100.0 %
:PROS 37->45|PS00517|RNASE_3_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30394.1 GT:GENE rnc GT:PRODUCT ribonuclease III GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 381121..381813 GB:FROM 381121 GB:TO 381813 GB:DIRECTION + GB:GENE rnc GB:PRODUCT ribonuclease III GB:PROTEIN_ID ACD30394.1 GB:DB_XREF GI:187712097 GB:GENE:GENE rnc LENGTH 230 SQ:AASEQ MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTKKNYERLEFLGDSVLSFVIAEVLYKQFTDLAEGKLSQLRSKLVKGTTLAQLASSLKMDEYIILGASEQGGHKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPIISSINLDTIKVKDSKSKLQEILLQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAEQKTAEKMIEMLSQQGLHEKK GT:EXON 1|1-230:0| SW:ID RNC_FRATM SW:DE RecName: Full=Ribonuclease 3; EC=3.1.26.3;AltName: Full=Ribonuclease III; Short=RNase III; SW:GN Name=rnc; OrderedLocusNames=FTM_0344; SW:KW Complete proteome; Cytoplasm; Endonuclease; Hydrolase; Nuclease;RNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->230|RNC_FRATM|e-126|100.0|230/230| GO:SWS:NREP 5 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0004519|"GO:endonuclease activity"|Endonuclease| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0004518|"GO:nuclease activity"|Nuclease| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| PROS 37->45|PS00517|RNASE_3_1|PDOC00448| BL:PDB:NREP 1 BL:PDB:REP 12->223|1yywC|3e-31|39.5|205/218| RP:PDB:NREP 1 RP:PDB:REP 1->221|3c4bA|1e-34|26.9|208/238| RP:PFM:NREP 2 RP:PFM:REP 37->124|PF00636|5e-18|50.0|88/93|Ribonuclease_3| RP:PFM:REP 155->221|PF00035|2e-05|44.4|63/66|dsrm| HM:PFM:NREP 2 HM:PFM:REP 37->124|PF00636|8.4e-27|47.7|88/105|Ribonuclease_3| HM:PFM:REP 154->221|PF00035|6.4e-12|37.9|66/67|dsrm| GO:PFM:NREP 5 GO:PFM GO:0003723|"GO:RNA binding"|PF00636|IPR000999| GO:PFM GO:0004525|"GO:ribonuclease III activity"|PF00636|IPR000999| GO:PFM GO:0006396|"GO:RNA processing"|PF00636|IPR000999| GO:PFM GO:0003725|"GO:double-stranded RNA binding"|PF00035|IPR001159| GO:PFM GO:0005622|"GO:intracellular"|PF00035|IPR001159| RP:SCP:NREP 2 RP:SCP:REP 6->147|1o0wA1|6e-39|35.9|142/169|a.149.1.1| RP:SCP:REP 133->230|1whnA|3e-14|17.4|92/128|d.50.1.1| HM:SCP:REP 1->151|1jfzA_|5.6e-48|49.0|147/0|a.149.1.1|1/1|RNase III domain-like| HM:SCP:REP 106->221|1whnA_|7.8e-21|40.2|92/0|d.50.1.1|1/1|dsRNA-binding domain-like| OP:NHOMO 1215 OP:NHOMOORG 1052 OP:PATTERN --------------------------------1-----111111--21-------------------- 1111111111111111111-11111111111111111111111111111111111111111111-1-111111111111111111111111111111--111111111111111111111111111111111111111111111111121332111111111122-12222111111111111-----11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11--1111111111111111111111111111111111-11111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111112111111111111111111111111111111-11111-1111111111111111111111111111111111111111111111111111111111111111111111-11111111111--111111111111111-111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111-11111111111111111111111111111111 ----311-----22322--12112121111111111111111111121-1-1----11-112-11111--22111111111111-121--112211-----2-111---241-12242111221331616J4142712223123-22211411623222132212223235233-1-------2-3655-43--1-121 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--- STR:NPRED 230 STR:RPRED 100.0 SQ:SECSTR HTTTHHHHHHHHTcccccHHHHHHHHccTTccccccHHHHHHHHHHHHHHHHHHHHHcTTcccHHHHHHHHHHHccHHHHHHHHHHTTGGGTcccccHHHcccccccHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHcTTTEEEcccEEcEcTTccEEcTTccEEEEEEEETTTEEEEEEEccHHHHHHHHHHHHHHHHHcccccccc DISOP:02AL 230-231| PSIPRED ccHHHHHHHHHHccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcHHHHHHHHHHcccHHHHHcccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccEEEEEEEEccccccEEEEEEEEccEEEEEEEEEccHHHHHHHHHHHHHHHHHHccccccc //