[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rnfB
DDBJ      :rnfB         iron-sulfur cluster-binding protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  300/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:209 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   73->139 1h7xB PDBj 3e-09 40.3 %
:RPS:PDB   76->132 1durA PDBj 2e-09 27.3 %
:RPS:SCOP  71->130 2v4jB1  d.58.1.5 * 3e-10 23.3 %
:HMM:SCOP  4->133 1h7wA5 d.58.1.5 * 4.6e-25 39.2 %
:RPS:PFM   11->41 PF04060 * FeS 5e-04 54.8 %
:HMM:PFM   77->98 PF00037 * Fer4 1.4e-10 59.1 22/24  
:HMM:PFM   107->129 PF00037 * Fer4 2.5e-07 47.8 23/24  
:HMM:PFM   11->42 PF04060 * FeS 9.3e-12 37.5 32/35  
:HMM:PFM   143->175 PF11890 * DUF3410 0.00036 15.2 33/82  
:BLT:SWISS 5->131 RNFB_HAHCH 3e-43 58.3 %
:BLT:SWISS 112->167 PNO_EUGGR 8e-04 32.7 %
:PROS 83->94|PS00198|4FE4S_FER_1
:PROS 113->124|PS00198|4FE4S_FER_1
:REPEAT 2|78->98|108->128

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31084.1 GT:GENE rnfB GT:PRODUCT iron-sulfur cluster-binding protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1292234..1292863 GB:FROM 1292234 GB:TO 1292863 GB:DIRECTION + GB:GENE rnfB GB:PRODUCT iron-sulfur cluster-binding protein GB:PROTEIN_ID ACD31084.1 GB:DB_XREF GI:187712787 GB:GENE:GENE rnfB LENGTH 209 SQ:AASEQ MIISIEAIDKVLPQTQCQKCTYPDCYSYAKAITNGEKHNKCITGGEKTLKELAKLLNKPEIPLDSSLGQEKPRAVAKIDESMCIGCEKCLLACPVDAIVGAKKLMHTIIEAECTGCELCVEPCPMDCISLVNLAADKQPNNLTNHAYTTQKNHYRDRYEYHKQRVSQTKAKQRDVYKNIATAQEIDKKAYIAASLAKFRNKKKSSPTNE GT:EXON 1|1-209:0| BL:SWS:NREP 2 BL:SWS:REP 5->131|RNFB_HAHCH|3e-43|58.3|127/197| BL:SWS:REP 112->167|PNO_EUGGR|8e-04|32.7|55/1803| PROS 83->94|PS00198|4FE4S_FER_1|PDOC00176| PROS 113->124|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 2|78->98|108->128| BL:PDB:NREP 1 BL:PDB:REP 73->139|1h7xB|3e-09|40.3|67/1019| RP:PDB:NREP 1 RP:PDB:REP 76->132|1durA|2e-09|27.3|55/55| RP:PFM:NREP 1 RP:PFM:REP 11->41|PF04060|5e-04|54.8|31/35|FeS| HM:PFM:NREP 4 HM:PFM:REP 77->98|PF00037|1.4e-10|59.1|22/24|Fer4| HM:PFM:REP 107->129|PF00037|2.5e-07|47.8|23/24|Fer4| HM:PFM:REP 11->42|PF04060|9.3e-12|37.5|32/35|FeS| HM:PFM:REP 143->175|PF11890|0.00036|15.2|33/82|DUF3410| GO:PFM:NREP 1 GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04060|IPR007202| RP:SCP:NREP 1 RP:SCP:REP 71->130|2v4jB1|3e-10|23.3|60/69|d.58.1.5| HM:SCP:REP 4->133|1h7wA5|4.6e-25|39.2|130/173|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 317 OP:NHOMOORG 305 OP:PATTERN -----------------------------1-------1---------------1-------------- --------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------1111----------------1------------------------------------111111111111111111111111111111111111111111111111111121211111111111111222---1------------------2-------1----------------------------1121111111112111111111111111111-1112111-11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---111111111121111-11111111111111111111111121111111111----211111111111111111111111111111111111111111111-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 154 STR:RPRED 73.7 SQ:SECSTR #######TTccEEEcGGGccccccccTTccccccccccccccccccccHHHHHHHHHHHHHHHHHHTTcTTcHHHcEEEcTTcccccccGGGcTTccEEccccTGcEEcTTTcccccHHHHHcTTccEEEccTccHHHHcEEEEccTTccEEEccccccTT################################################ PSIPRED cccHHHHHHHHHHHcccccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHcccccccccccccccccEEEEEccccccccccHHHHcccccEEEccccEEEEcHHHccccccHHHHcccccEEEEEccccccccccccHHHHHHHHHHHcccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //