[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rnpA
DDBJ      :rnpA         ribonuclease P protein component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.14.1
:117 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->106 1d6tA PDBj 6e-05 30.4 %
:RPS:PDB   7->117 1d6tA PDBj 1e-10 24.3 %
:RPS:SCOP  7->117 1a6fA  d.14.1.2 * 1e-09 27.1 %
:HMM:SCOP  10->118 1nz0A_ d.14.1.2 * 1.2e-15 20.6 %
:RPS:PFM   7->115 PF00825 * Ribonuclease_P 9e-07 31.1 %
:HMM:PFM   9->115 PF00825 * Ribonuclease_P 6.7e-21 35.0 103/111  
:BLT:SWISS 12->103 RNPA_VIBCM 7e-12 36.3 %
:REPEAT 2|42->77|79->117

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31422.1 GT:GENE rnpA GT:PRODUCT ribonuclease P protein component GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1725138..1725491 GB:FROM 1725138 GB:TO 1725491 GB:DIRECTION + GB:GENE rnpA GB:PRODUCT ribonuclease P protein component GB:PROTEIN_ID ACD31422.1 GB:DB_XREF GI:187713125 GB:GENE:GENE rnpA LENGTH 117 SQ:AASEQ MLHNFCLTKQNILDKNEIQQAFDSVENKLSTLHFTFLLAKRNIKDPGLCVILTKKNIKKATKRNLCRRIIKESFRLHKDLLDHKSLIVLSKKTAAQATKEELWQSITEFECFLKKLH GT:EXON 1|1-117:0| BL:SWS:NREP 1 BL:SWS:REP 12->103|RNPA_VIBCM|7e-12|36.3|91/118| NREPEAT 1 REPEAT 2|42->77|79->117| BL:PDB:NREP 1 BL:PDB:REP 51->106|1d6tA|6e-05|30.4|56/117| RP:PDB:NREP 1 RP:PDB:REP 7->117|1d6tA|1e-10|24.3|107/117| RP:PFM:NREP 1 RP:PFM:REP 7->115|PF00825|9e-07|31.1|106/111|Ribonuclease_P| HM:PFM:NREP 1 HM:PFM:REP 9->115|PF00825|6.7e-21|35.0|103/111|Ribonuclease_P| GO:PFM:NREP 3 GO:PFM GO:0000049|"GO:tRNA binding"|PF00825|IPR000100| GO:PFM GO:0004526|"GO:ribonuclease P activity"|PF00825|IPR000100| GO:PFM GO:0008033|"GO:tRNA processing"|PF00825|IPR000100| RP:SCP:NREP 1 RP:SCP:REP 7->117|1a6fA|1e-09|27.1|107/113|d.14.1.2| HM:SCP:REP 10->118|1nz0A_|1.2e-15|20.6|107/109|d.14.1.2|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111--1-----11111------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 94.9 SQ:SECSTR ######ccGGGcccccHHHHHHHHccEEcccccEEcEEccTTccccccEEEEcccccccTTHHHHHHHHHHHHHHHGGGTcccccEEEEEccGGGGccTTHHHHHHHHHTTHHHHHT DISOP:02AL 117-118| PSIPRED cccccccHHHccccHHHHHHHHHcccccccccEEEEEEccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHcHHHcccccEEEEEccccccccHHHHHHHHHHHHHHHHHHc //