[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpiA
DDBJ      :rpiA         ribose 5-phosphate isomerase A
Swiss-Prot:RPIA_FRATW   RecName: Full=Ribose-5-phosphate isomerase A;         EC=5.3.1.6;AltName: Full=Phosphoriboisomerase A;         Short=PRI;

Homologs  Archaea  66/68 : Bacteria  592/915 : Eukaryota  174/199 : Viruses  0/175   --->[See Alignment]
c.124.1d.58.40
:224 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   30->223 1m0sA PDBj 8e-60 56.7 %
:RPS:PDB   31->209 3dlxC PDBj 1e-26 14.3 %
:RPS:SCOP  54->149 1o8bA1  c.124.1.4 * 1e-30 40.2 %
:RPS:SCOP  133->204 1ks2A2  d.58.40.1 * 7e-29 61.1 %
:HMM:SCOP  7->153 1m0sA1 c.124.1.4 * 1.6e-40 45.6 %
:HMM:SCOP  132->203 1m0sA2 d.58.40.1 * 3.7e-24 52.8 %
:RPS:PFM   56->218 PF06026 * Rib_5-P_isom_A 2e-41 56.2 %
:HMM:PFM   54->219 PF06026 * Rib_5-P_isom_A 1.8e-63 50.9 165/173  
:HMM:PFM   13->52 PF00455 * DeoR 0.00061 33.3 39/157  
:BLT:SWISS 1->224 RPIA_FRATW e-117 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30745.1 GT:GENE rpiA GT:PRODUCT ribose 5-phosphate isomerase A GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(847186..847860) GB:FROM 847186 GB:TO 847860 GB:DIRECTION - GB:GENE rpiA GB:PRODUCT ribose 5-phosphate isomerase A GB:PROTEIN_ID ACD30745.1 GB:DB_XREF GI:187712448 GB:GENE:GENE rpiA LENGTH 224 SQ:AASEQ MFFNKKNNQDELKKLAATEAAKSITTEITLGVGTGSTVGFLIEELVNYRDKIKTVVSSSEDSTRKLKALGFDVVDLNYAGEIDLYIDGADECNNHKELIKGGGAALTREKICVAAAKKFICIIDESKKVNTLGNFPLPIEVIPMARSYIARQIVKLGGQPVYREQTITDNGNVILDVYNLKIDNPLKLETELNQITGVVTNGIFALKPADTVIMATKDSNIVVL GT:EXON 1|1-224:0| SW:ID RPIA_FRATW SW:DE RecName: Full=Ribose-5-phosphate isomerase A; EC=5.3.1.6;AltName: Full=Phosphoriboisomerase A; Short=PRI; SW:GN Name=rpiA; OrderedLocusNames=FTW_1255; SW:KW Complete proteome; Isomerase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->224|RPIA_FRATW|e-117|100.0|224/224| GO:SWS:NREP 1 GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| SEG 11->22|elkklaateaak| BL:PDB:NREP 1 BL:PDB:REP 30->223|1m0sA|8e-60|56.7|194/219| RP:PDB:NREP 1 RP:PDB:REP 31->209|3dlxC|1e-26|14.3|168/467| RP:PFM:NREP 1 RP:PFM:REP 56->218|PF06026|2e-41|56.2|162/173|Rib_5-P_isom_A| HM:PFM:NREP 2 HM:PFM:REP 54->219|PF06026|1.8e-63|50.9|165/173|Rib_5-P_isom_A| HM:PFM:REP 13->52|PF00455|0.00061|33.3|39/157|DeoR| GO:PFM:NREP 2 GO:PFM GO:0004751|"GO:ribose-5-phosphate isomerase activity"|PF06026|IPR004788| GO:PFM GO:0009052|"GO:pentose-phosphate shunt, non-oxidative branch"|PF06026|IPR004788| RP:SCP:NREP 2 RP:SCP:REP 54->149|1o8bA1|1e-30|40.2|92/96|c.124.1.4| RP:SCP:REP 133->204|1ks2A2|7e-29|61.1|72/72|d.58.40.1| HM:SCP:REP 7->153|1m0sA1|1.6e-40|45.6|147/148|c.124.1.4|1/1|NagB/RpiA/CoA transferase-like| HM:SCP:REP 132->203|1m0sA2|3.7e-24|52.8|72/0|d.58.40.1|1/1|D-ribose-5-phosphate isomerase (RpiA), lid domain| OP:NHOMO 902 OP:NHOMOORG 832 OP:PATTERN 111111111111111111111111111-1111111111111111111111111111111111111-11 --------------------------------------11-------------------------------1111111----1-----111--1-----------2-11-111111111111111-----------11111----1111111111111111111111111111111111111111111---1--11111111-1111111-----111----21-111111-1-11111111111111111111111121211122111111123211111111111111111111111111111111111111111111111---12------------------------------------------------11111111111111111111111111-111111-1111111111111111111111111111111111111111111111111111------------------------------------1-11111111111111111111111111111111211111111111111111111322111111111111111-1-------1------------------11---------------------------111111111111111111111111111111111-1111111111111111111111111111-1111111111111111111111111111111--1---1111111111111111122222222212111111111111111111111111111111111111111111121111111111111111111111111111111111111112111111111111111111--------1111111111--------------------------------------- 11--111-1---11111111111111111111111--111111111---111111111111111111111111211111-11111111-13111111111111321111-212-122111211111-1-121-11111-111111-11--1-111111111-11111111411111111811111423713212211-2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 201 STR:RPRED 89.7 SQ:SECSTR #######################ccTTcccEEEETTTEEEEccGGGccTTcccTTcccccEEEEEEEccHHHHHHHHHTTcccEEEEcccEEETTccEccccTTHccHHHHTccTTcEEEEEcccccGGGcEcccEEccccccccccccccEEEcccEEEEEEcEEETTTEEEEEEEcTTcTccHHHHHTTcccccEEEEEEEEcccccHHHHcHHHccEEEEE PSIPRED ccccccccHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHcccEEEEHHHcccccEEEEccHHccccccEEEccHHHHHHHHHHHHcccEEEEEEEccccccccccccccEEEEEcHHHHHHHHHHHccccEEEcccEEcccccEEEEEEccccccHHHHHHHHHccccEEEEcEEEcccccEEEEEccccEEEEc //