[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplA
DDBJ      :rplA         50S ribosomal protein L1
Swiss-Prot:RL1_FRATT    RecName: Full=50S ribosomal protein L1;

Homologs  Archaea  3/68 : Bacteria  909/915 : Eukaryota  93/199 : Viruses  0/175   --->[See Alignment]
e.24.1
:231 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->230 3fik5 PDBj 3e-71 63.0 %
:RPS:PDB   6->227 1ad2A PDBj 2e-58 39.2 %
:RPS:SCOP  6->227 1ad2A  e.24.1.1 * 7e-59 39.2 %
:HMM:SCOP  6->228 1ad2A_ e.24.1.1 * 6.8e-77 50.2 %
:RPS:PFM   16->220 PF00687 * Ribosomal_L1 1e-35 46.5 %
:HMM:PFM   17->221 PF00687 * Ribosomal_L1 7.4e-83 54.6 205/209  
:BLT:SWISS 1->231 RL1_FRATT e-112 100.0 %
:PROS 121->139|PS01199|RIBOSOMAL_L1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30286.1 GT:GENE rplA GT:PRODUCT 50S ribosomal protein L1 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 225562..226257 GB:FROM 225562 GB:TO 226257 GB:DIRECTION + GB:GENE rplA GB:PRODUCT 50S ribosomal protein L1 GB:PROTEIN_ID ACD30286.1 GB:DB_XREF GI:187711989 GB:GENE:GENE rplA LENGTH 231 SQ:AASEQ MAKVSKRMKEISAKINAEKKYPVSEAFDLLREVSSVKFVESVDVSVALGVDPRKSDQVVRGASVLPNGTGKTVRVAVFAKGPAADAAKEAGAEVVGMEDLADEVKKGNMDFDVVIASPDSMRVVGQLGQILGPKGLMPNPKVGTVTMDVAKAVRDAKAGQVRYRVDKAGIIHTTIGKVNFTSDALKQNLEQLLTDLKKAKPAVSKGIYLKKVSVSSTMGPGINVDFSDLNI GT:EXON 1|1-231:0| SW:ID RL1_FRATT SW:DE RecName: Full=50S ribosomal protein L1; SW:GN Name=rplA; OrderedLocusNames=FTT0141; SW:KW Complete proteome; Repressor; Ribonucleoprotein; Ribosomal protein;RNA-binding; rRNA-binding; Translation regulation; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->231|RL1_FRATT|e-112|100.0|231/231| GO:SWS:NREP 6 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0006417|"GO:regulation of translation"|Translation regulation| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 121->139|PS01199|RIBOSOMAL_L1|PDOC00922| SEG 75->95|vavfakgpaadaakeagaevv| BL:PDB:NREP 1 BL:PDB:REP 1->230|3fik5|3e-71|63.0|230/234| RP:PDB:NREP 1 RP:PDB:REP 6->227|1ad2A|2e-58|39.2|222/224| RP:PFM:NREP 1 RP:PFM:REP 16->220|PF00687|1e-35|46.5|202/206|Ribosomal_L1| HM:PFM:NREP 1 HM:PFM:REP 17->221|PF00687|7.4e-83|54.6|205/209|Ribosomal_L1| GO:PFM:NREP 2 GO:PFM GO:0003723|"GO:RNA binding"|PF00687|IPR002143| GO:PFM GO:0006396|"GO:RNA processing"|PF00687|IPR002143| RP:SCP:NREP 1 RP:SCP:REP 6->227|1ad2A|7e-59|39.2|222/224|e.24.1.1| HM:SCP:REP 6->228|1ad2A_|6.8e-77|50.2|223/224|e.24.1.1|1/1|Ribosomal protein L1| OP:NHOMO 1054 OP:NHOMOORG 1005 OP:PATTERN --------------------------------1-1-----------------1--------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 --------------111111111111-1111-1111111111111111111111111-1111111-1---11-1--11111-----11--1-11-1111---11-1--3----------------------------------------------------------------1-2222Q1-2223234132112111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 230 STR:RPRED 99.6 SQ:SECSTR ccccccccTTTTTcccTTccccHHHHHHHHHTTcccccccEEEEEEEEcccTTcGGGccEEEEEccccccTTccEEEEccTHHHHHHHHTTccEEEcGGGHHHHHTTcccccEEEEcGGGHHHHHHHHHHHHHHTccccTTTTcccccHHHHHHHHHTTEEEEEccTTcEEEEEEEETTccHHHHHHHHHHHHHHHHTTccTTcccccEEEEEEEcTTcccEEEcTTccc# PSIPRED cccHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccEEEEEEEccccccccccccEEEEcccccccccEEEEEccHHHHHHHHHcccccccHHHHHHHHHcccccccEEEEcHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHcccEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEccccccEEEcHHHccc //