[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplB
DDBJ      :rplB         50S ribosomal protein L2
Swiss-Prot:RL2_FRATM    RecName: Full=50S ribosomal protein L2;

Homologs  Archaea  68/68 : Bacteria  909/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
b.34.5b.40.4
:274 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->273 2i2tC PDBj 2e-98 62.8 %
:RPS:PDB   8->272 3bboE PDBj 1e-80 45.0 %
:RPS:SCOP  6->125 2hgjD2  b.40.4.5 * 8e-27 51.7 %
:RPS:SCOP  128->268 1s72A1  b.34.5.3 * 6e-32 36.2 %
:HMM:SCOP  39->127 1ffkA2 b.40.4.5 * 2.2e-30 60.7 %
:HMM:SCOP  128->269 1ffkA1 b.34.5.3 * 5.2e-64 61.3 %
:RPS:PFM   43->119 PF00181 * Ribosomal_L2 2e-24 70.1 %
:RPS:PFM   127->253 PF03947 * Ribosomal_L2_C 1e-37 62.2 %
:HMM:PFM   126->252 PF03947 * Ribosomal_L2_C 1e-62 63.8 127/130  
:HMM:PFM   43->115 PF00181 * Ribosomal_L2 5.4e-36 69.9 73/77  
:BLT:SWISS 1->274 RL2_FRATM e-153 100.0 %
:PROS 219->230|PS00467|RIBOSOMAL_L2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31346.1 GT:GENE rplB GT:PRODUCT 50S ribosomal protein L2 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1636057..1636881) GB:FROM 1636057 GB:TO 1636881 GB:DIRECTION - GB:GENE rplB GB:PRODUCT 50S ribosomal protein L2 GB:PROTEIN_ID ACD31346.1 GB:DB_XREF GI:187713049 GB:GENE:GENE rplB LENGTH 274 SQ:AASEQ MIEIKKAKPTSPGRRHVVSVKNTELHTGKPFKGLVEVKKSKAGRNNTGRITVRHQGGGHKQHYRVVDFKRNKDDITAKVERIEYDPNRSANIALVLYADGERRYIVAPKGLKKDMSVISGEKVDVAVGNCMPLRNIPLGTVIHNIEMKPKKGAQMIRSAGTFAQLVGKDNAYAIIRLRSGEMRRVLLDCRAVIGVVSNSEHNLKSLGKAGAKRWRGIRPTVRGVAMNPVDHPHGGGEGRTSGGRHPVTPWGIPTKGYKTRRNKRSNKLIVQKRK GT:EXON 1|1-274:0| SW:ID RL2_FRATM SW:DE RecName: Full=50S ribosomal protein L2; SW:GN Name=rplB; OrderedLocusNames=FTM_1524; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->274|RL2_FRATM|e-153|100.0|274/274| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 219->230|PS00467|RIBOSOMAL_L2|PDOC00384| SEG 234->243|gggegrtsgg| BL:PDB:NREP 1 BL:PDB:REP 4->273|2i2tC|2e-98|62.8|269/271| RP:PDB:NREP 1 RP:PDB:REP 8->272|3bboE|1e-80|45.0|260/266| RP:PFM:NREP 2 RP:PFM:REP 43->119|PF00181|2e-24|70.1|77/77|Ribosomal_L2| RP:PFM:REP 127->253|PF03947|1e-37|62.2|127/129|Ribosomal_L2_C| HM:PFM:NREP 2 HM:PFM:REP 126->252|PF03947|1e-62|63.8|127/130|Ribosomal_L2_C| HM:PFM:REP 43->115|PF00181|5.4e-36|69.9|73/77|Ribosomal_L2| GO:PFM:NREP 8 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00181|IPR002171| GO:PFM GO:0005622|"GO:intracellular"|PF00181|IPR002171| GO:PFM GO:0005840|"GO:ribosome"|PF00181|IPR002171| GO:PFM GO:0006412|"GO:translation"|PF00181|IPR002171| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF03947|IPR002171| GO:PFM GO:0005622|"GO:intracellular"|PF03947|IPR002171| GO:PFM GO:0005840|"GO:ribosome"|PF03947|IPR002171| GO:PFM GO:0006412|"GO:translation"|PF03947|IPR002171| RP:SCP:NREP 2 RP:SCP:REP 6->125|2hgjD2|8e-27|51.7|120/122|b.40.4.5| RP:SCP:REP 128->268|1s72A1|6e-32|36.2|141/147|b.34.5.3| HM:SCP:REP 39->127|1ffkA2|2.2e-30|60.7|89/90|b.40.4.5|1/1|Nucleic acid-binding proteins| HM:SCP:REP 128->269|1ffkA1|5.2e-64|61.3|142/0|b.34.5.3|1/1|Translation proteins SH3-like domain| OP:NHOMO 1451 OP:NHOMOORG 1172 OP:PATTERN 11111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 2311111183212222213122222122222222222412222222222222222221222221322212211331311122221134-23222222222221545113142322232121222342425C3-23512-221233-221122122233132222231322312233222Q22222646H2631111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 271 STR:RPRED 98.9 SQ:SECSTR ###cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEGGGccccccccccccccccccccccTTTccccccccccTTccccccTTcccccccccEEccccccccHHHHccccccccccTTTcccccccccccTTTcccccccccccTTccccccccccccccccccccccccccccccc DISOP:02AL 274-275| PSIPRED cccccccccccccccEEEEEccccccccccccccEEEEEEcccccccEEEEEEEcccccccccEEEEEEEcccccEEEEEEEEEccccccEEEEEEEccccEEEEEEccccccccEEEEccccccccccEEEHHHcccccEEEEEEEcccccEEEEEEcccEEEEEEEcccEEEEEcccccEEEEccccEEEEEEEccccccccEEHHHHHHHHccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEcc //