[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplC
DDBJ      :rplC         50S ribosomal protein L3
Swiss-Prot:RL3_FRATW    RecName: Full=50S ribosomal protein L3;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  176/199 : Viruses  0/175   --->[See Alignment]
b.43.3
:210 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->210 1vs6D PDBj 4e-81 68.8 %
:RPS:PDB   57->209 3bboF PDBj 2e-13 40.1 %
:RPS:SCOP  4->210 1vs6D1  b.43.3.2 * 8e-77 69.1 %
:HMM:SCOP  1->209 1ffkB_ b.43.3.2 * 6.2e-82 54.8 %
:RPS:PFM   9->196 PF00297 * Ribosomal_L3 4e-41 54.0 %
:HMM:PFM   9->203 PF00297 * Ribosomal_L3 2.8e-43 40.4 193/263  
:BLT:SWISS 1->210 RL3_FRATW e-120 100.0 %
:PROS 102->125|PS00474|RIBOSOMAL_L3

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31349.1 GT:GENE rplC GT:PRODUCT 50S ribosomal protein L3 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1637855..1638487) GB:FROM 1637855 GB:TO 1638487 GB:DIRECTION - GB:GENE rplC GB:PRODUCT 50S ribosomal protein L3 GB:PROTEIN_ID ACD31349.1 GB:DB_XREF GI:187713052 GB:GENE:GENE rplC LENGTH 210 SQ:AASEQ MSLGLVGRKCGMTRIFTEDGVSIPVTVVQVEPNKVTQVKTVEKDGYNAIQVTTGFKKRSNVNKPMAGHYAKASVEPGRGLWEFTVDAAAEYQVGSSFDATMFEAGQKVDVRGVSKGKGFQGGVKRHNFATQDATHGNSLSHRVHGSTGQNQTPGRVFKNKKMAGHLGNENVTIQSLEVVRVDAENGLLLLKGGIPGSVGGDIIVTPAVKS GT:EXON 1|1-210:0| SW:ID RL3_FRATW SW:DE RecName: Full=50S ribosomal protein L3; SW:GN Name=rplC; OrderedLocusNames=FTW_1757; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->210|RL3_FRATW|e-120|100.0|210/210| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 102->125|PS00474|RIBOSOMAL_L3|PDOC00385| BL:PDB:NREP 1 BL:PDB:REP 3->210|1vs6D|4e-81|68.8|208/209| RP:PDB:NREP 1 RP:PDB:REP 57->209|3bboF|2e-13|40.1|152/154| RP:PFM:NREP 1 RP:PFM:REP 9->196|PF00297|4e-41|54.0|187/196|Ribosomal_L3| HM:PFM:NREP 1 HM:PFM:REP 9->203|PF00297|2.8e-43|40.4|193/263|Ribosomal_L3| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00297|IPR000597| GO:PFM GO:0005622|"GO:intracellular"|PF00297|IPR000597| GO:PFM GO:0005840|"GO:ribosome"|PF00297|IPR000597| GO:PFM GO:0006412|"GO:translation"|PF00297|IPR000597| RP:SCP:NREP 1 RP:SCP:REP 4->210|1vs6D1|8e-77|69.1|207/209|b.43.3.2| HM:SCP:REP 1->209|1ffkB_|6.2e-82|54.8|208/337|b.43.3.2|1/1|Translation proteins| OP:NHOMO 1153 OP:NHOMOORG 1083 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111-1111111111111111111111111111112111111211111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 22--111-2---1111111111111111111111111111111111111111111111111-111111-1111111111111111111-12111111111111111-1212221121--1111-1111-241-112-11-1-111111111--2-1111-111111-111111222122S2222232431221131111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 208 STR:RPRED 99.0 SQ:SECSTR ##ccccccccccccccTTccccccccccccccccccccccccccccccccccccccccccccHHHHTTcccccccccccccccccccccTTTTccccccccccccccccccccccccccccccccccccccccccccccTTTcccccccccccTTTTTTccccccccccccccccccEEEEETTTTEEEEcccccccccccccccccccc PSIPRED ccccEEEEEccEEEEEcccccEEEEEEEEEcccEEEEEEEccccccEEEEEEEcccccccccHHHHHHHHHccccHHcEEEEEEEccHHccccccEEEHHHcccccEEEEEEEEccccEEEEEEEcccccccccccccccccccEEEccccccccccccccccccccccEEEEEccEEEEEcccccEEEEEEccccccccEEEEEEcccc //