[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplE
DDBJ      :rplE         50S ribosomal protein L5
Swiss-Prot:RL5_FRATM    RecName: Full=50S ribosomal protein L5;

Homologs  Archaea  68/68 : Bacteria  912/915 : Eukaryota  110/199 : Viruses  0/175   --->[See Alignment]
d.77.1
:179 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->178 1vs6F PDBj 3e-66 64.4 %
:RPS:PDB   1->178 3d5bG PDBj 4e-73 52.2 %
:RPS:SCOP  1->178 1iq4A  d.77.1.1 * 2e-69 59.6 %
:HMM:SCOP  1->179 1mjiA_ d.77.1.1 * 1.1e-76 58.1 %
:RPS:PFM   24->80 PF00281 * Ribosomal_L5 4e-15 66.1 %
:RPS:PFM   84->178 PF00673 * Ribosomal_L5_C 2e-38 70.5 %
:HMM:PFM   84->178 PF00673 * Ribosomal_L5_C 1.5e-44 66.3 95/95  
:HMM:PFM   24->80 PF00281 * Ribosomal_L5 3.8e-26 58.9 56/56  
:BLT:SWISS 1->179 RL5_FRATM 1e-99 100.0 %
:PROS 57->73|PS00358|RIBOSOMAL_L5

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31337.1 GT:GENE rplE GT:PRODUCT 50S ribosomal protein L5 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1632501..1633040) GB:FROM 1632501 GB:TO 1633040 GB:DIRECTION - GB:GENE rplE GB:PRODUCT 50S ribosomal protein L5 GB:PROTEIN_ID ACD31337.1 GB:DB_XREF GI:187713040 GB:GENE:GENE rplE LENGTH 179 SQ:AASEQ MARLKDYYQKKLVAKLKTELGLDNIMEVPAIKKITLNMGVGDAAKDKKIMTFALNDLTAIAGQKPVVTKSKKSIAGFKIRDGWPIGAKVTLRGDRMYEFLDRLITIAIPRIRDFRGLSAKSFDGRGNYSLGMREQISFPEIDYDKVDSIRGLDISITTTAKNDDQGRALLKAFGFPFKS GT:EXON 1|1-179:0| SW:ID RL5_FRATM SW:DE RecName: Full=50S ribosomal protein L5; SW:GN Name=rplE; OrderedLocusNames=FTM_1515; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->179|RL5_FRATM|1e-99|100.0|179/179| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 57->73|PS00358|RIBOSOMAL_L5|PDOC00309| BL:PDB:NREP 1 BL:PDB:REP 2->178|1vs6F|3e-66|64.4|177/178| RP:PDB:NREP 1 RP:PDB:REP 1->178|3d5bG|4e-73|52.2|178/181| RP:PFM:NREP 2 RP:PFM:REP 24->80|PF00281|4e-15|66.1|56/56|Ribosomal_L5| RP:PFM:REP 84->178|PF00673|2e-38|70.5|95/95|Ribosomal_L5_C| HM:PFM:NREP 2 HM:PFM:REP 84->178|PF00673|1.5e-44|66.3|95/95|Ribosomal_L5_C| HM:PFM:REP 24->80|PF00281|3.8e-26|58.9|56/56|Ribosomal_L5| GO:PFM:NREP 8 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00281|IPR002132| GO:PFM GO:0005622|"GO:intracellular"|PF00281|IPR002132| GO:PFM GO:0005840|"GO:ribosome"|PF00281|IPR002132| GO:PFM GO:0006412|"GO:translation"|PF00281|IPR002132| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00673|IPR002132| GO:PFM GO:0005622|"GO:intracellular"|PF00673|IPR002132| GO:PFM GO:0005840|"GO:ribosome"|PF00673|IPR002132| GO:PFM GO:0006412|"GO:translation"|PF00673|IPR002132| RP:SCP:NREP 1 RP:SCP:REP 1->178|1iq4A|2e-69|59.6|178/179|d.77.1.1| HM:SCP:REP 1->179|1mjiA_|1.1e-76|58.1|179/180|d.77.1.1|1/1|Ribosomal protein L5| OP:NHOMO 1178 OP:NHOMOORG 1090 OP:PATTERN 11111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111112111111111111111111-11111111111111111111111111111111 -1--11-11--1112212212221111111-112222222222---2211111122111222221222-1221223332312211233--1-11-2222-111457--21-----------------------------------------------------1--1--21----1---------2156212111-111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 99.4 SQ:SECSTR ccHHHHHHHTTHHHHHHHTTccccTTTcccEEEEEEEEcccTTTTcHHHHHHHHHHHHHHHTccccccccccccTTTTccccccccEEEEEcHHHHHHHHHHHHHTTTTTcTTcccccTTccccccEEccEEccGGGccccccTTccccccEEEEEEEccccHHHHHHHHHHHTcccc# PSIPRED ccHHHHHHHHHHHHHHHHHHccccHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHHHccccEEEEEcccccccccccccEEEEEEEEcHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEHHHHHHccccccccccccccEEEEEEEccccHHHHHHHHHHHcccccc //