[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplF
DDBJ      :rplF         50S ribosomal protein L6
Swiss-Prot:RL6_FRATM    RecName: Full=50S ribosomal protein L6;

Homologs  Archaea  19/68 : Bacteria  909/915 : Eukaryota  107/199 : Viruses  0/175   --->[See Alignment]
d.141.1
:178 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->173 2gyaE PDBj 3e-49 52.7 %
:RPS:PDB   1->178 3bboI PDBj 3e-51 42.4 %
:RPS:SCOP  8->83 1rl6A1  d.141.1.1 * 1e-18 50.7 %
:RPS:SCOP  84->170 1rl6A2  d.141.1.1 * 1e-31 52.9 %
:HMM:SCOP  5->83 1ffk11 d.141.1.1 * 2.9e-16 44.9 %
:HMM:SCOP  84->172 1rl6A2 d.141.1.1 * 2.6e-30 58.4 %
:RPS:PFM   103->165 PF00347 * Ribosomal_L6 2e-05 42.4 %
:HMM:PFM   11->83 PF00347 * Ribosomal_L6 9.9e-16 37.5 72/77  
:HMM:PFM   91->165 PF00347 * Ribosomal_L6 2.9e-23 30.6 72/77  
:BLT:SWISS 1->178 RL6_FRATM 8e-98 100.0 %
:PROS 155->163|PS00525|RIBOSOMAL_L6_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31334.1 GT:GENE rplF GT:PRODUCT 50S ribosomal protein L6 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1631207..1631743) GB:FROM 1631207 GB:TO 1631743 GB:DIRECTION - GB:GENE rplF GB:PRODUCT 50S ribosomal protein L6 GB:PROTEIN_ID ACD31334.1 GB:DB_XREF GI:187713037 GB:GENE:GENE rplF LENGTH 178 SQ:AASEQ MSRIGKKPVVIPSGVTINVAAGNKVEVKGAKATLSKAFSTDVTFSVADNVATITPNNNSKNAVAQSGTARAILSNMVEGVSKGFERKLKIIGVGYRAKAQGNELNLTLGFSHPVVYKLPQGITAETPAPTEIILKGADKELLGKVASEIREYRKPEPYKGKGVRYEDEYVAKKEAKKK GT:EXON 1|1-178:0| SW:ID RL6_FRATM SW:DE RecName: Full=50S ribosomal protein L6; SW:GN Name=rplF; OrderedLocusNames=FTM_1512; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->178|RL6_FRATM|8e-98|100.0|178/178| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 155->163|PS00525|RIBOSOMAL_L6_1|PDOC00454| BL:PDB:NREP 1 BL:PDB:REP 6->173|2gyaE|3e-49|52.7|167/167| RP:PDB:NREP 1 RP:PDB:REP 1->178|3bboI|3e-51|42.4|177/182| RP:PFM:NREP 1 RP:PFM:REP 103->165|PF00347|2e-05|42.4|59/74|Ribosomal_L6| HM:PFM:NREP 2 HM:PFM:REP 11->83|PF00347|9.9e-16|37.5|72/77|Ribosomal_L6| HM:PFM:REP 91->165|PF00347|2.9e-23|30.6|72/77|Ribosomal_L6| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00347|IPR020040| GO:PFM GO:0005840|"GO:ribosome"|PF00347|IPR020040| GO:PFM GO:0006412|"GO:translation"|PF00347|IPR020040| GO:PFM GO:0019843|"GO:rRNA binding"|PF00347|IPR020040| RP:SCP:NREP 2 RP:SCP:REP 8->83|1rl6A1|1e-18|50.7|75/75|d.141.1.1| RP:SCP:REP 84->170|1rl6A2|1e-31|52.9|87/89|d.141.1.1| HM:SCP:REP 5->83|1ffk11|2.9e-16|44.9|78/79|d.141.1.1|1/1|Ribosomal protein L6| HM:SCP:REP 84->172|1rl6A2|2.6e-30|58.4|89/89|d.141.1.1|1/1|Ribosomal protein L6| OP:NHOMO 1083 OP:NHOMOORG 1035 OP:PATTERN -----1---------1-1-111-----------------1111-111-------111--11---1--- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 -----1------11111111111111-111111111-111111111-111111111111---112213-1122111111112221111-12111111111111111--2------------------------------------------------------1----------11131H111122465122------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 100.0 SQ:SECSTR ccccccccccccTTccEEEcTccEEEEccccccEEEEcccccEEEcccccEEEEcccccTTHHHHHHHHTTTTTHHHHHTTTcEEEcEEcccTTccEEEcccEEEEcccccccEEEEccccEEEEcccTTccEEEEcccHHHHHHHHHTTccccccTTTccccEETTccccccccccc PSIPRED ccccccEEEEcccccEEEEEcccEEEEEccccEEEEEccccEEEEEEccEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccEEEEEEccEEEEEEcccEEEEEEcccccEEEEccccEEEEEEccHHHHHHHHHHHcccccccccccccEEEccEEEEEEEcccc //