[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplI
DDBJ      :rplI         50S ribosomal protein L9
Swiss-Prot:RL9_FRATW    RecName: Full=50S ribosomal protein L9;

Homologs  Archaea  0/68 : Bacteria  611/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.100.1d.99.1
:151 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->148 1vs6H PDBj 2e-29 65.3 %
:RPS:PDB   1->150 1divA PDBj 6e-35 32.2 %
:RPS:SCOP  1->44 1divA2  d.100.1.1 * 1e-15 47.7 %
:RPS:SCOP  78->150 1divA1  d.99.1.1 * 3e-19 37.5 %
:HMM:SCOP  1->55 2j01I2 d.100.1.1 * 4.3e-18 61.8 %
:HMM:SCOP  56->150 1divA1 d.99.1.1 * 2.1e-22 36.3 %
:RPS:PFM   1->44 PF01281 * Ribosomal_L9_N 1e-08 61.4 %
:RPS:PFM   78->149 PF03948 * Ribosomal_L9_C 3e-10 47.9 %
:HMM:PFM   63->148 PF03948 * Ribosomal_L9_C 6.4e-28 43.5 85/87  
:HMM:PFM   1->48 PF01281 * Ribosomal_L9_N 3.2e-27 66.7 48/48  
:BLT:SWISS 1->151 RL9_FRATW 1e-59 100.0 %
:PROS 13->40|PS00651|RIBOSOMAL_L9
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30831.1 GT:GENE rplI GT:PRODUCT 50S ribosomal protein L9 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 973654..974109 GB:FROM 973654 GB:TO 974109 GB:DIRECTION + GB:GENE rplI GB:PRODUCT 50S ribosomal protein L9 GB:PROTEIN_ID ACD30831.1 GB:DB_XREF GI:187712534 GB:GENE:GENE rplI LENGTH 151 SQ:AASEQ MQVILKEKVENLGVLGDIVNVKPGYARNFLIPFGKAVQATQANIKAFEAQKAELEKAEKARFEAAVAVADAIKDKVYTIAAQAGEGGKLFGSVGTAEVAEAVSNQSGKKIEKSQVRMPEGVIRSIGEFELTVHVYTDVDADIKVNVVAAEA GT:EXON 1|1-151:0| SW:ID RL9_FRATW SW:DE RecName: Full=50S ribosomal protein L9; SW:GN Name=rplI; OrderedLocusNames=FTW_0970; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->151|RL9_FRATW|1e-59|100.0|151/151| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 13->40|PS00651|RIBOSOMAL_L9|PDOC00560| SEG 45->75|kafeaqkaelekaekarfeaavavadaikdk| BL:PDB:NREP 1 BL:PDB:REP 1->148|1vs6H|2e-29|65.3|147/149| RP:PDB:NREP 1 RP:PDB:REP 1->150|1divA|6e-35|32.2|149/149| RP:PFM:NREP 2 RP:PFM:REP 1->44|PF01281|1e-08|61.4|44/48|Ribosomal_L9_N| RP:PFM:REP 78->149|PF03948|3e-10|47.9|71/87|Ribosomal_L9_C| HM:PFM:NREP 2 HM:PFM:REP 63->148|PF03948|6.4e-28|43.5|85/87|Ribosomal_L9_C| HM:PFM:REP 1->48|PF01281|3.2e-27|66.7|48/48|Ribosomal_L9_N| RP:SCP:NREP 2 RP:SCP:REP 1->44|1divA2|1e-15|47.7|44/55|d.100.1.1| RP:SCP:REP 78->150|1divA1|3e-19|37.5|72/94|d.99.1.1| HM:SCP:REP 1->55|2j01I2|4.3e-18|61.8|55/0|d.100.1.1|1/1|L9 N-domain-like| HM:SCP:REP 56->150|1divA1|2.1e-22|36.3|91/94|d.99.1.1|1/1|Ribosomal protein L9 C-domain| OP:NHOMO 613 OP:NHOMOORG 611 OP:PATTERN -------------------------------------------------------------------- 111------------------1---1--------------1----11--11-11---1----11---111--11111111-1111111---1-1--1--11----1-1----------------11111111111111111------------------------------------------11111211111--------1------1111-1--1111-1-11111111111111111111111111111--1-----1-1--------1---------------------------------------------------11111111111-1-11---1111-111111111111111111111-11111111111111111-1111111-1111111111111-111111111111111----1111--1-111111111111111111111111111111111111-1---------------111111111111111111111111111111111111111111111111111---1111---11111111111111111111111111111111111111111111111111111-11-------111111111-11--111111111111111111-11111111111111-1111--1----11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111-1--------------------------11-1111111--1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 150 STR:RPRED 99.3 SQ:SECSTR cEEEEcccccccGGGTEEEEccTTHHHHTTTTTTcEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccEEEEEcccGGGEEEEEEcHHHHHHHHHHHHcccccGGGcccccccEEEcEEEEEEEEEETTEEEEEEEEEEEcc# PSIPRED cEEEEccccccccccccEEEEccccEEEEEcccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccEEEEccHHHHHHHHHHHHcccccHHHEEccccccccEEEEEEEEEEcccEEEEEEEEEEEccc //