[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplJ
DDBJ      :rplJ         50S ribosomal protein L10
Swiss-Prot:RL10_FRATM   RecName: Full=50S ribosomal protein L10;

Homologs  Archaea  0/68 : Bacteria  854/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
d.58.62
:172 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->172 1zaxA PDBj 3e-18 34.1 %
:RPS:SCOP  3->172 1zavA1  d.58.62.1 * 1e-32 32.9 %
:RPS:PFM   6->100 PF00466 * Ribosomal_L10 1e-13 46.3 %
:HMM:PFM   6->101 PF00466 * Ribosomal_L10 1.3e-28 38.5 96/100  
:BLT:SWISS 1->172 RL10_FRATM 4e-92 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30287.1 GT:GENE rplJ GT:PRODUCT 50S ribosomal protein L10 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 226427..226945 GB:FROM 226427 GB:TO 226945 GB:DIRECTION + GB:GENE rplJ GB:PRODUCT 50S ribosomal protein L10 GB:PROTEIN_ID ACD30287.1 GB:DB_XREF GI:187711990 GB:GENE:GENE rplJ LENGTH 172 SQ:AASEQ MALRIEDKKAIVAEVAEQMSSALSAAVADYRGLTVNEMTSLRKQARESGVYLRVVRNNLARLAIKGTEFECLADALKGPLVLALSKDAPGAAAKLFKNFQKDHNAFEVKNLAMSGELFGPEKLDDFAKLPTREEALATLLNVMQAPVTKFVRTLNEIPSQAVRVFAAVGDSK GT:EXON 1|1-172:0| SW:ID RL10_FRATM SW:DE RecName: Full=50S ribosomal protein L10; SW:GN Name=rplJ; OrderedLocusNames=FTM_0207; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->172|RL10_FRATM|4e-92|100.0|172/172| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 6->172|1zaxA|3e-18|34.1|167/174| RP:PFM:NREP 1 RP:PFM:REP 6->100|PF00466|1e-13|46.3|95/100|Ribosomal_L10| HM:PFM:NREP 1 HM:PFM:REP 6->101|PF00466|1.3e-28|38.5|96/100|Ribosomal_L10| GO:PFM:NREP 2 GO:PFM GO:0005622|"GO:intracellular"|PF00466|IPR001790| GO:PFM GO:0042254|"GO:ribosome biogenesis"|PF00466|IPR001790| RP:SCP:NREP 1 RP:SCP:REP 3->172|1zavA1|1e-32|32.9|170/177|d.58.62.1| OP:NHOMO 865 OP:NHOMOORG 861 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1-111111111111111111111111111111---11-11111111111111111111111111-111---11--1---1-1111-1-11--------------111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111-111111111111111111111111111111-11-211111111111111111111----------111111111111111----11111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111-1111111111-1-111111111111-111-11 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2121-11-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 167 STR:RPRED 97.1 SQ:SECSTR #####cHHHHHHHHHHHHHTTccEEEEEccTTccHHHHHHHHHHHHHHGEEEEEccHHHHHHHHHHTTccccGGGGccccEEEEcccccHHHHHHHHHHHHHTTcGGEEEEEETTEEEETTHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc DISOP:02AL 172-173| PSIPRED ccccHHHHHHHHHHHHHHHHHccEEEEEEEccccHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHccccHHHHHHccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEEEccEEccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //