[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplK
DDBJ      :rplK         50S ribosomal protein L11
Swiss-Prot:RL11_FRATW   RecName: Full=50S ribosomal protein L11;

Homologs  Archaea  49/68 : Bacteria  910/915 : Eukaryota  171/199 : Viruses  0/175   --->[See Alignment]
a.4.7d.47.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->141 2k3fA PDBj 6e-42 56.9 %
:RPS:PDB   3->142 3bboK PDBj 3e-37 50.4 %
:RPS:SCOP  10->72 1mmsA2  d.47.1.1 * 6e-20 67.7 %
:RPS:SCOP  69->142 1hc8A  a.4.7.1 * 5e-20 44.6 %
:HMM:SCOP  2->86 1wibA_ d.47.1.1 * 2.6e-29 46.8 %
:HMM:SCOP  69->142 1hc8A_ a.4.7.1 * 5.7e-27 62.2 %
:RPS:PFM   10->68 PF03946 * Ribosomal_L11_N 3e-18 69.5 %
:RPS:PFM   73->141 PF00298 * Ribosomal_L11 4e-10 50.7 %
:HMM:PFM   9->68 PF03946 * Ribosomal_L11_N 3.6e-36 68.3 60/60  
:HMM:PFM   73->141 PF00298 * Ribosomal_L11 2e-33 62.3 69/69  
:BLT:SWISS 1->144 RL11_FRATW 3e-70 100.0 %
:PROS 128->143|PS00359|RIBOSOMAL_L11
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30285.1 GT:GENE rplK GT:PRODUCT 50S ribosomal protein L11 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 225125..225559 GB:FROM 225125 GB:TO 225559 GB:DIRECTION + GB:GENE rplK GB:PRODUCT 50S ribosomal protein L11 GB:PROTEIN_ID ACD30285.1 GB:DB_XREF GI:187711988 GB:GENE:GENE rplK LENGTH 144 SQ:AASEQ MAKKKIEAIIKLQVAAGKANPSPPIGPALGQHGVNIMGFCKEFNAKTQGMEPGMPIPVEISVYSDRSFTFEMKTPPASYLIKKAINVKSGSSKPSKEFVGTITRAQLEEIAKVKDPDLTAADLDAAVRIIAGSARSMGVKVEGV GT:EXON 1|1-144:0| SW:ID RL11_FRATW SW:DE RecName: Full=50S ribosomal protein L11; SW:GN Name=rplK; OrderedLocusNames=FTW_0230; SW:KW Complete proteome; Methylation; Ribonucleoprotein; Ribosomal protein;RNA-binding; rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->144|RL11_FRATW|3e-70|100.0|144/144| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 128->143|PS00359|RIBOSOMAL_L11|PDOC00310| SEG 115->126|dpdltaadldaa| BL:PDB:NREP 1 BL:PDB:REP 4->141|2k3fA|6e-42|56.9|137/141| RP:PDB:NREP 1 RP:PDB:REP 3->142|3bboK|3e-37|50.4|139/145| RP:PFM:NREP 2 RP:PFM:REP 10->68|PF03946|3e-18|69.5|59/60|Ribosomal_L11_N| RP:PFM:REP 73->141|PF00298|4e-10|50.7|69/69|Ribosomal_L11| HM:PFM:NREP 2 HM:PFM:REP 9->68|PF03946|3.6e-36|68.3|60/60|Ribosomal_L11_N| HM:PFM:REP 73->141|PF00298|2e-33|62.3|69/69|Ribosomal_L11| GO:PFM:NREP 6 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF03946|IPR000911| GO:PFM GO:0005840|"GO:ribosome"|PF03946|IPR000911| GO:PFM GO:0006412|"GO:translation"|PF03946|IPR000911| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00298|IPR000911| GO:PFM GO:0005840|"GO:ribosome"|PF00298|IPR000911| GO:PFM GO:0006412|"GO:translation"|PF00298|IPR000911| RP:SCP:NREP 2 RP:SCP:REP 10->72|1mmsA2|6e-20|67.7|62/63|d.47.1.1| RP:SCP:REP 69->142|1hc8A|5e-20|44.6|74/74|a.4.7.1| HM:SCP:REP 2->86|1wibA_|2.6e-29|46.8|79/0|d.47.1.1|1/1|Ribosomal L11/L12e N-terminal domain| HM:SCP:REP 69->142|1hc8A_|5.7e-27|62.2|74/0|a.4.7.1|1/1|Ribosomal protein L11, C-terminal domain| OP:NHOMO 1201 OP:NHOMOORG 1130 OP:PATTERN --1--1-1111111111------11111-111--1111111111---1111111111111111-11-1 1111111111111111111-11111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111311111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11------312-111111111111111111111111-1-11111111111111111111111111111111111111-1111111111-11111111111111112--3-11111111-1-11-12-2-453-212111-111111111-11111--1111-1111-111-11112222N222124224-321131112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 97.9 SQ:SECSTR ##ccccccEEEEcccTTcccccTTTTTTTTTTcccTTccHHHHHHHGGGccccccccEEEEEcccccEEEEEccccTTHHHHHHHTcccccccTTTcccEEEcHHHHHHHHHHTcTTcccccHHHHHHHHHHHHTTTTEEEcc# DISOP:02AL 144-145| PSIPRED cccccEEEEEEEEEEccccccccccHHHHHcccccHHHHHHHHHHHHHHcccccEEEEEEEEEcccEEEEEEccccHHHHHHHHccccccccccccEEEEEEcHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccEEEEEc //