[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplL
DDBJ      :rplL         ribosomal protein L7/L12
Swiss-Prot:RL7_FRATM    RecName: Full=50S ribosomal protein L7/L12;

Homologs  Archaea  0/68 : Bacteria  639/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.108.1d.45.1
:126 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->97 1rquA PDBj 2e-22 76.9 %
:RPS:PDB   3->97 1dd3A PDBj 8e-16 43.2 %
:RPS:SCOP  3->34 1dd3A1  a.108.1.1 * 4e-07 40.6 %
:RPS:SCOP  59->100 1ctfA  d.45.1.1 * 4e-10 71.4 %
:HMM:SCOP  3->62 1dd3A1 a.108.1.1 * 2.5e-16 54.4 %
:HMM:SCOP  59->126 1ctfA_ d.45.1.1 * 4.2e-24 72.1 %
:RPS:PFM   60->97 PF00542 * Ribosomal_L12 3e-06 71.1 %
:HMM:PFM   59->126 PF00542 * Ribosomal_L12 3.9e-32 75.0 68/68  
:HMM:PFM   6->51 PF02249 * MCR_alpha 0.00015 32.6 46/127  
:BLT:SWISS 1->100 RL7_FRATM 1e-36 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30288.1 GT:GENE rplL GT:PRODUCT ribosomal protein L7/L12 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 227008..227388 GB:FROM 227008 GB:TO 227388 GB:DIRECTION + GB:GENE rplL GB:PRODUCT ribosomal protein L7/L12 GB:PROTEIN_ID ACD30288.1 GB:DB_XREF GI:187711991 GB:GENE:GENE rplL LENGTH 126 SQ:AASEQ MAITKEDILNAVAEMSVMDVCDLVKMMEDKFGVSAAAATVAVAAGPVAGPAEAAEEKTEFDVVLVDAGSNKIAAIKAVRGATGLGLKEAKDAVEGTPFTVKEAASKEEAEALKKQLEEAGAKVELK GT:EXON 1|1-126:0| SW:ID RL7_FRATM SW:DE RecName: Full=50S ribosomal protein L7/L12; SW:GN Name=rplL; OrderedLocusNames=FTM_0208; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->100|RL7_FRATM|1e-36|100.0|100/126| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| SEG 35->56|aaaatvavaagpvagpaeaaee| SEG 101->122|keaaskeeaealkkqleeagak| BL:PDB:NREP 1 BL:PDB:REP 2->97|1rquA|2e-22|76.9|91/120| RP:PDB:NREP 1 RP:PDB:REP 3->97|1dd3A|8e-16|43.2|95/128| RP:PFM:NREP 1 RP:PFM:REP 60->97|PF00542|3e-06|71.1|38/68|Ribosomal_L12| HM:PFM:NREP 2 HM:PFM:REP 59->126|PF00542|3.9e-32|75.0|68/68|Ribosomal_L12| HM:PFM:REP 6->51|PF02249|0.00015|32.6|46/127|MCR_alpha| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00542|IPR013823| GO:PFM GO:0005622|"GO:intracellular"|PF00542|IPR013823| GO:PFM GO:0005840|"GO:ribosome"|PF00542|IPR013823| GO:PFM GO:0006412|"GO:translation"|PF00542|IPR013823| RP:SCP:NREP 2 RP:SCP:REP 3->34|1dd3A1|4e-07|40.6|32/57|a.108.1.1| RP:SCP:REP 59->100|1ctfA|4e-10|71.4|42/68|d.45.1.1| HM:SCP:REP 3->62|1dd3A1|2.5e-16|54.4|57/57|a.108.1.1|1/1|Ribosomal protein L7/12, oligomerisation (N-terminal) domain| HM:SCP:REP 59->126|1ctfA_|4.2e-24|72.1|68/68|d.45.1.1|1/1|ClpS-like| OP:NHOMO 662 OP:NHOMOORG 644 OP:PATTERN -------------------------------------------------------------------- 11111-------11-11-----111-------1---1------111-11------1----1111----1111---1111111111111---1-111---1111---1-----------------111-11-1111111111111-1----11-----------1-1-----------------1111111--1111111111111111111111111111111111111111111111111111111111111111-----111-----11-1111111--------------------------------------------111111111111111111111111-1-111111111111--11111111111-----11111--111--11-1-111111111111------1-1111--11111111111------111121---11111111-111-111-----------------------------1-----1111111111111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111-111111111111111111111111-111111111111111111111111111111111-111111111111111-111111111-11-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111--11--11111111-------1------1----------111--1111-111-11 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1H111---------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 78.6 SQ:SECSTR #cccHHHHHHHHTTccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHTccEEEEEEEcTTcHHHHHHHHHHHHcccHHHHHHHHTTTTEEE########################## PSIPRED ccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHccEEEEEEEcccHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHccccHHHHHHHHHHHHHcccEEEEc //