[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplM
DDBJ      :rplM         50S ribosomal protein L13
Swiss-Prot:RL13_FRATW   RecName: Full=50S ribosomal protein L13;

Homologs  Archaea  3/68 : Bacteria  909/915 : Eukaryota  166/199 : Viruses  0/175   --->[See Alignment]
c.21.1
:142 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->142 2i2tJ PDBj 1e-57 68.3 %
:RPS:PDB   5->138 3d5bN PDBj 1e-44 56.0 %
:RPS:SCOP  1->138 1vs6J1  c.21.1.1 * 1e-59 69.6 %
:HMM:SCOP  15->142 1j3aA_ c.21.1.1 * 2.8e-46 56.9 %
:RPS:PFM   15->138 PF00572 * Ribosomal_L13 1e-36 61.3 %
:HMM:PFM   15->141 PF00572 * Ribosomal_L13 1.3e-58 57.5 127/128  
:BLT:SWISS 1->142 RL13_FRATW 4e-81 100.0 %
:PROS 105->127|PS00783|RIBOSOMAL_L13

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30970.1 GT:GENE rplM GT:PRODUCT 50S ribosomal protein L13 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1144403..1144831 GB:FROM 1144403 GB:TO 1144831 GB:DIRECTION + GB:GENE rplM GB:PRODUCT 50S ribosomal protein L13 GB:PROTEIN_ID ACD30970.1 GB:DB_XREF GI:187712673 GB:GENE:GENE rplM LENGTH 142 SQ:AASEQ MKTFTAKPSNIKREWLLIDATDKTLGRLATEVAMILRGKNKPEYTPHMDTGDYVVIVNAEKVAVTGNKRKAKTYYHHTGYIGGIKSVSFEKLIATHPERAIEKAVRGMLPRTPLGRTMFKKLKVYAGEAHPHTAQQPKAHNI GT:EXON 1|1-142:0| SW:ID RL13_FRATW SW:DE RecName: Full=50S ribosomal protein L13; SW:GN Name=rplM; OrderedLocusNames=FTW_0567; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->142|RL13_FRATW|4e-81|100.0|142/142| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 105->127|PS00783|RIBOSOMAL_L13|PDOC00625| BL:PDB:NREP 1 BL:PDB:REP 1->142|2i2tJ|1e-57|68.3|142/142| RP:PDB:NREP 1 RP:PDB:REP 5->138|3d5bN|1e-44|56.0|134/137| RP:PFM:NREP 1 RP:PFM:REP 15->138|PF00572|1e-36|61.3|124/128|Ribosomal_L13| HM:PFM:NREP 1 HM:PFM:REP 15->141|PF00572|1.3e-58|57.5|127/128|Ribosomal_L13| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00572|IPR005822| GO:PFM GO:0005622|"GO:intracellular"|PF00572|IPR005822| GO:PFM GO:0005840|"GO:ribosome"|PF00572|IPR005822| GO:PFM GO:0006412|"GO:translation"|PF00572|IPR005822| RP:SCP:NREP 1 RP:SCP:REP 1->138|1vs6J1|1e-59|69.6|138/140|c.21.1.1| HM:SCP:REP 15->142|1j3aA_|2.8e-46|56.9|116/142|c.21.1.1|1/1|Ribosomal protein L13| OP:NHOMO 1138 OP:NHOMOORG 1078 OP:PATTERN ------------------------------1-----------------------1-1----------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111121111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 1---111-31--211-111-11111111111-1111-111111111111111111111-1111111111111111-111111111111-11111111111111112-141-111-121--111111-1-121-1-11-1-1-11111-111-11---1211-121111111--112222M2222242541321121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 100.0 SQ:SECSTR cccccccccccccccEEEccTTccHHHHHHHHHHHHTGGGcTTccTTTcccccEEEcccTTccccccTTTTcEEEcccccTTcccEEEHHHHHHccTHHHHHHHHHHHccccHHHHHHHHTEEEcccccccccccccEEccc PSIPRED cccEEccHHHEEEEEEEEEcccccHHHHHHHHHHHHccccccEEccccccccEEEEEEcccEEEEcccccEEEEEEccccccccccccHHHHHcccHHHHHHHHHHccccccHHHHHHHHcccccccccccHHHcccccccc //