[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplO
DDBJ      :rplO         50S ribosomal protein L15
Swiss-Prot:RL15_FRATM   RecName: Full=50S ribosomal protein L15;

Homologs  Archaea  0/68 : Bacteria  847/915 : Eukaryota  55/199 : Viruses  0/175   --->[See Alignment]
c.12.1
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->118 2zjrI PDBj 7e-20 44.1 %
:RPS:PDB   1->143 3bboN PDBj 5e-31 42.0 %
:RPS:SCOP  1->143 1vs6L1  c.12.1.1 * 2e-44 60.8 %
:HMM:SCOP  4->143 2gyaJ1 c.12.1.1 * 6.4e-49 56.4 %
:RPS:PFM   26->142 PF00828 * Ribosomal_L18e 2e-19 53.0 %
:HMM:PFM   27->142 PF00828 * Ribosomal_L18e 2.2e-27 39.8 113/129  
:BLT:SWISS 1->143 RL15_FRATM 1e-78 100.0 %
:PROS 109->139|PS00475|RIBOSOMAL_L15

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31330.1 GT:GENE rplO GT:PRODUCT 50S ribosomal protein L15 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1629673..1630104) GB:FROM 1629673 GB:TO 1630104 GB:DIRECTION - GB:GENE rplO GB:PRODUCT 50S ribosomal protein L15 GB:PROTEIN_ID ACD31330.1 GB:DB_XREF GI:187713033 GB:GENE:GENE rplO LENGTH 143 SQ:AASEQ MKLNTLAPAAGSKSAPKRLGRGIGSGLGKTSGKGHKGQKARSGGYHKVGFEGGQMPLQRRLPKFGFTSASKRHVAEIRLHELNNLVADEVTLDTLKDFGLIRKDIKTVKVIASGEIQKAVSLKGIACTKGAKEAIEKAGGKVE GT:EXON 1|1-143:0| SW:ID RL15_FRATM SW:DE RecName: Full=50S ribosomal protein L15; SW:GN Name=rplO; OrderedLocusNames=FTM_1508; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->143|RL15_FRATM|1e-78|100.0|143/143| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 109->139|PS00475|RIBOSOMAL_L15|PDOC00386| BL:PDB:NREP 1 BL:PDB:REP 6->118|2zjrI|7e-20|44.1|111/141| RP:PDB:NREP 1 RP:PDB:REP 1->143|3bboN|5e-31|42.0|143/176| RP:PFM:NREP 1 RP:PFM:REP 26->142|PF00828|2e-19|53.0|115/129|Ribosomal_L18e| HM:PFM:NREP 1 HM:PFM:REP 27->142|PF00828|2.2e-27|39.8|113/129|Ribosomal_L18e| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00828|IPR000039| GO:PFM GO:0005622|"GO:intracellular"|PF00828|IPR000039| GO:PFM GO:0005840|"GO:ribosome"|PF00828|IPR000039| GO:PFM GO:0006412|"GO:translation"|PF00828|IPR000039| RP:SCP:NREP 1 RP:SCP:REP 1->143|1vs6L1|2e-44|60.8|143/144|c.12.1.1| HM:SCP:REP 4->143|2gyaJ1|6.4e-49|56.4|140/0|c.12.1.1|1/1|Ribosomal proteins L15p and L18e| OP:NHOMO 934 OP:NHOMOORG 902 OP:PATTERN -------------------------------------------------------------------- 111-111-11111111111-11--11111111111111-1-11111111111111111--1111-1-111111111111111111111111111111--111111111-111111111111111111111111111-----11111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111-111111-111-1111-111-111111-111111111---111-111-11111-----111-----1--11111111-1111111111111111111111111111111111111111111111111111111111111-11111111111111111-111111111111111111111111111111-----111111111111111111111111111111111111111111111111-1111111-1111-111111111111111-1111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111-1--1--111111---11111-1111-11111111111 -----11----------------------------------------------------------1111-1111-111-11111---1---1-1-11111---111-121------------------------------------------------1--------------1-1111E1221251-4-222112-12 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 100.0 SQ:SECSTR ccccccccccccccccccccccccccccccccccccccGGGTcccccTTcccccccTTccccccccccccccccccccccccccccTTTTcccccccccccccccccccccccccccccccccccccTGGGTTccTTTTccEE DISOP:02AL 143-144| PSIPRED cccHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccEEEEEEHHHHHHHccccccHHHHHHcccccccccEEEEEEcccccccEEEEEEEEcHHHHHHHHHcccEEc //