[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplQ
DDBJ      :rplQ         50S ribosomal protein L17
Swiss-Prot:RL17_FRATW   RecName: Full=50S ribosomal protein L17;

Homologs  Archaea  0/68 : Bacteria  900/915 : Eukaryota  119/199 : Viruses  0/175   --->[See Alignment]
d.188.1
:145 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->144 1vs6N PDBj 4e-43 67.7 %
:RPS:PDB   1->133 3bboP PDBj 3e-43 44.0 %
:RPS:SCOP  14->134 1gd8A  d.188.1.1 * 5e-35 50.0 %
:HMM:SCOP  14->134 1gd8A_ d.188.1.1 * 2.1e-38 62.5 %
:RPS:PFM   20->133 PF01196 * Ribosomal_L17 8e-19 61.9 %
:HMM:PFM   20->133 PF01196 * Ribosomal_L17 2.1e-38 59.8 97/97  
:BLT:SWISS 1->145 RL17_FRATW 4e-80 100.0 %
:PROS 34->56|PS01167|RIBOSOMAL_L17

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31323.1 GT:GENE rplQ GT:PRODUCT 50S ribosomal protein L17 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1625146..1625583) GB:FROM 1625146 GB:TO 1625583 GB:DIRECTION - GB:GENE rplQ GB:PRODUCT 50S ribosomal protein L17 GB:PROTEIN_ID ACD31323.1 GB:DB_XREF GI:187713026 GB:GENE:GENE rplQ LENGTH 145 SQ:AASEQ MRHRKQGRKFGRTSSHRKAMFKNMSASLINHELIKTTLPKAKELRTIVEPLVTLAKREHKLRQELDTNSNEFKAQSVALRRQAFDFLRNKAAVTKLFEEFGARYAERAGGYTRILKCGYRFGDKAPMAFIELVDRPQVEEAADEE GT:EXON 1|1-145:0| SW:ID RL17_FRATW SW:DE RecName: Full=50S ribosomal protein L17; SW:GN Name=rplQ; OrderedLocusNames=FTW_1732; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->145|RL17_FRATW|4e-80|100.0|145/145| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 34->56|PS01167|RIBOSOMAL_L17|PDOC00897| BL:PDB:NREP 1 BL:PDB:REP 1->144|1vs6N|4e-43|67.7|127/127| RP:PDB:NREP 1 RP:PDB:REP 1->133|3bboP|3e-43|44.0|116/116| RP:PFM:NREP 1 RP:PFM:REP 20->133|PF01196|8e-19|61.9|97/97|Ribosomal_L17| HM:PFM:NREP 1 HM:PFM:REP 20->133|PF01196|2.1e-38|59.8|97/97|Ribosomal_L17| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01196|IPR000456| GO:PFM GO:0005622|"GO:intracellular"|PF01196|IPR000456| GO:PFM GO:0005840|"GO:ribosome"|PF01196|IPR000456| GO:PFM GO:0006412|"GO:translation"|PF01196|IPR000456| RP:SCP:NREP 1 RP:SCP:REP 14->134|1gd8A|5e-35|50.0|104/105|d.188.1.1| HM:SCP:REP 14->134|1gd8A_|2.1e-38|62.5|104/105|d.188.1.1|1/1|Prokaryotic ribosomal protein L17| OP:NHOMO 1069 OP:NHOMOORG 1019 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111-1111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111-1-111--1111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111-11111111-111-1111 12--111------11111-111111111111-1111111111111111111--1-1111111-11111-111111111111111-111--111111-1-1121112-131---11------------------------------------------11--------------112222I1112243441322221112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 94.5 SQ:SECSTR ccTTcccccTTccGGGHHHHHHHHHHHHHHTccEEEcHHHHHHHHHHHHHHHHHHHHc#######ccTTccHHHcTTHHHHHHHTTcccTTHHHHHTTccGGGGcccccccEEccccccccccccccEEEEEcccccccccccc# DISOP:02AL 145-146| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHccEEEEcHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccEEEEEEccccccccccccc //