[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplR
DDBJ      :rplR         50S ribosomal protein L18
Swiss-Prot:RL18_FRATW   RecName: Full=50S ribosomal protein L18;

Homologs  Archaea  0/68 : Bacteria  852/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
c.55.4
:117 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->117 1vs6O PDBj 2e-31 55.6 %
:RPS:PDB   2->117 3bboQ PDBj 2e-28 47.4 %
:RPS:SCOP  1->117 1vs6O1  c.55.4.1 * 5e-37 65.0 %
:HMM:SCOP  19->117 1ovyA_ c.55.4.1 * 6.4e-37 54.6 %
:RPS:PFM   12->117 PF00861 * Ribosomal_L18p 2e-15 48.1 %
:HMM:PFM   4->117 PF00861 * Ribosomal_L18p 2.7e-35 36.0 114/119  
:BLT:SWISS 1->117 RL18_FRATW 8e-64 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31333.1 GT:GENE rplR GT:PRODUCT 50S ribosomal protein L18 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1630831..1631184) GB:FROM 1630831 GB:TO 1631184 GB:DIRECTION - GB:GENE rplR GB:PRODUCT 50S ribosomal protein L18 GB:PROTEIN_ID ACD31333.1 GB:DB_XREF GI:187713036 GB:GENE:GENE rplR LENGTH 117 SQ:AASEQ MDKKTARLSRSKRTRIKLRELGHTRLCVYRTPRHVYAQVISGDGSTVLVAASTVEKDVKAKCKYTGNVESAAIVGEIIADRCKEKGISQVAFDRSGYKYHGRVKALVEAAREHGLQF GT:EXON 1|1-117:0| SW:ID RL18_FRATW SW:DE RecName: Full=50S ribosomal protein L18; SW:GN Name=rplR; OrderedLocusNames=FTW_1742; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->117|RL18_FRATW|8e-64|100.0|117/117| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| BL:PDB:NREP 1 BL:PDB:REP 1->117|1vs6O|2e-31|55.6|117/117| RP:PDB:NREP 1 RP:PDB:REP 2->117|3bboQ|2e-28|47.4|116/122| RP:PFM:NREP 1 RP:PFM:REP 12->117|PF00861|2e-15|48.1|106/118|Ribosomal_L18p| HM:PFM:NREP 1 HM:PFM:REP 4->117|PF00861|2.7e-35|36.0|114/119|Ribosomal_L18p| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00861|IPR005484| GO:PFM GO:0005622|"GO:intracellular"|PF00861|IPR005484| GO:PFM GO:0005840|"GO:ribosome"|PF00861|IPR005484| GO:PFM GO:0006412|"GO:translation"|PF00861|IPR005484| RP:SCP:NREP 1 RP:SCP:REP 1->117|1vs6O1|5e-37|65.0|117/117|c.55.4.1| HM:SCP:REP 19->117|1ovyA_|6.4e-37|54.6|97/0|c.55.4.1|1/1|Translational machinery components| OP:NHOMO 890 OP:NHOMOORG 871 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111-1-111-11111111----111---1----11111111111111111111111--111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111---1111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111----------1111111111111111111-111111111111111111111111111111111111111111111-111111-11111111111111111111111111111111111111111111111--1-1111---11------1-11111-1---11111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111-----111-1111111111111111-1 ------------------------------------------------------------------------------------------------------------2------------------------------------------------------1-----------1111A111124132-11------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 100.0 SQ:SECSTR ccccccGGGTccccccGGGGccccccEEEEccccEEEEEEccTTccEEEEEEHHHHHHHHcTcccccHHHHHHHHHHcccHHHHTccccccccccccccccTTHHHHHHHTTTTccc DISOP:02AL 117-118| PSIPRED ccHHHHHHHHHHHHHHHHHcccccEEEEEEccccEEEEEEEccccEEEEEEEcHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHccccc //