[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplS
DDBJ      :rplS         50S ribosomal protein L19
Swiss-Prot:RL19_FRATN   RecName: Full=50S ribosomal protein L19;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  23/199 : Viruses  0/175   --->[See Alignment]
b.34.5
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->115 1vs6P PDBj 3e-38 58.4 %
:RPS:PDB   1->112 3bboR PDBj 1e-33 30.6 %
:RPS:SCOP  2->114 2j01T1  b.34.5.6 * 1e-36 48.7 %
:HMM:SCOP  3->116 2gyaN1 b.34.5.6 * 3.8e-38 54.4 %
:RPS:PFM   6->115 PF01245 * Ribosomal_L19 5e-29 59.1 %
:HMM:PFM   4->114 PF01245 * Ribosomal_L19 2e-49 58.6 111/113  
:BLT:SWISS 1->115 RL19_FRATN 2e-62 100.0 %
:PROS 87->102|PS01015|RIBOSOMAL_L19

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30298.1 GT:GENE rplS GT:PRODUCT 50S ribosomal protein L19 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 242189..242536 GB:FROM 242189 GB:TO 242536 GB:DIRECTION + GB:GENE rplS GB:PRODUCT 50S ribosomal protein L19 GB:PROTEIN_ID ACD30298.1 GB:DB_XREF GI:187712001 GB:GENE:GENE rplS LENGTH 115 SQ:AASEQ MKNKFVELVEKSQLRTDLPEFNPGDSITVNLWIKEGDKQRIQAFKGFVLRKRNRGLHSAFTVRKMSSGMGVERTFQTHSPLIDSIIVEKRADVRRAKLYYMRGLTGKAARIKEKV GT:EXON 1|1-115:0| SW:ID RL19_FRATN SW:DE RecName: Full=50S ribosomal protein L19; SW:GN Name=rplS; OrderedLocusNames=FTN_1559; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->115|RL19_FRATN|2e-62|100.0|115/115| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 87->102|PS01015|RIBOSOMAL_L19|PDOC00778| BL:PDB:NREP 1 BL:PDB:REP 3->115|1vs6P|3e-38|58.4|113/114| RP:PDB:NREP 1 RP:PDB:REP 1->112|3bboR|1e-33|30.6|111/113| RP:PFM:NREP 1 RP:PFM:REP 6->115|PF01245|5e-29|59.1|110/112|Ribosomal_L19| HM:PFM:NREP 1 HM:PFM:REP 4->114|PF01245|2e-49|58.6|111/113|Ribosomal_L19| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01245|IPR001857| GO:PFM GO:0005622|"GO:intracellular"|PF01245|IPR001857| GO:PFM GO:0005840|"GO:ribosome"|PF01245|IPR001857| GO:PFM GO:0006412|"GO:translation"|PF01245|IPR001857| RP:SCP:NREP 1 RP:SCP:REP 2->114|2j01T1|1e-36|48.7|113/137|b.34.5.6| HM:SCP:REP 3->116|2gyaN1|3.8e-38|54.4|114/0|b.34.5.6|1/1|Translation proteins SH3-like domain| OP:NHOMO 959 OP:NHOMOORG 930 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-1111111111111111111111111111 --------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------11112E122112252-32--11111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 100.0 SQ:SECSTR cccccTTHHHHTTccccccccccccccccccccccccccccccccccccccccccccccccccccccccTTTcccccccccccccccccccccccccccccccccTTcccccccc DISOP:02AL 115-116| PSIPRED ccHHHHHHHHHHHHcccccccccccEEEEEEEEEccccEEEEEEEEEEEEEcccccccEEEEEEcccccEEEEEEEcccccEEEEEEEEEEccHHHHHHHHHcccccEEEEEEcc //